Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021772 pacid=23159355 polypeptide=Lus10021772 locus=Lus10021772.g ID=Lus10021772.BGIv1.0 annot-version=v1.0 ATGGGAAAAGGGTTTCACACTAGCATGAATTGTTTCAGTAAGGAGGTTGTGAATTTAAGGAGTCTTCAGTGTAACCAGGCTCCAACTTCATCAACGGAGG ACCGGTCAATATTCGATCGATTCTGGCACAGACACGACGTGGATGGGATCGACGATAGAGGGATTGCGGTTTCCGGCGGAGAAGGATTGAAGCTGGAGCT TCCAATCGTCGTGGTAGATGAGATCGAGATCGAGGTCGTGGGCATATTCGATGAGGGAATGGGTCGAAAGAGATGA
AA sequence Show only first row Show all	>Lus10021772 pacid=23159355 polypeptide=Lus10021772 locus=Lus10021772.g ID=Lus10021772.BGIv1.0 annot-version=v1.0 MGKGFHTSMNCFSKEVVNLRSLQCNQAPTSSTEDRSIFDRFWHRHDVDGIDDRGIAVSGGEGLKLELPIVVVDEIEIEVVGIFDEGMGRKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021772 [exp]	0	1
AT1G54070			Dormancy/auxin associated fami...		Lus10013180 [exp]	14.8	0.6018
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10018251 [exp]	24.0	0.4988
AT4G33300		ADR1-L1	ADR1-like 1 (.1.2)		Lus10021769 [exp]	26.0	0.5891
					Lus10020479 [exp]	43.7	0.5190
AT2G34930			disease resistance family prot...		Lus10000220 [exp]	69.5	0.4615
AT5G65550			UDP-Glycosyltransferase superf...		Lus10026411 [exp]	101.9	0.4628
AT5G67240		SDN3	small RNA degrading nuclease 3...		Lus10010220 [exp]	136.1	0.4368
AT5G22860			Serine carboxypeptidase S28 fa...		Lus10021400 [exp]	167.8	0.4269
AT3G46350			Leucine-rich repeat protein ki...		Lus10030627 [exp]	169.2	0.4379
AT1G14650			SWAP (Suppressor-of-White-APri...		Lus10015391 [exp]	193.7	0.4175

Compare expression of checked genes

Lus10021772 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.