Lus10021778 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16690 192 / 9e-58 ORC3, ATORC3 origin recognition complex subunit 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034596 221 / 1e-68 AT5G16690 614 / 0.0 origin recognition complex subunit 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G077200 188 / 2e-56 AT5G16690 734 / 0.0 origin recognition complex subunit 3 (.1)
PFAM info
Representative CDS sequence
>Lus10021778 pacid=23159363 polypeptide=Lus10021778 locus=Lus10021778.g ID=Lus10021778.BGIv1.0 annot-version=v1.0
ATGTGCCCGGTCGAGTGTGTAGCCTTTCACGAAGTTGTATGTTTTAACGGTGTCGATAAACTTCAAGCGTCTTTAGTTGGTGATACGAGACGAAGAATCC
AAGTCGATTTTCAAAAGTTCCATGATATCATCCGTTGCAGCTGCTGCCAAAAGAGAGGCAGTACCCTTTTGCCATCAATGCCTGATTCCTCGATTATGTA
TTCACTGGCTCAGGAGCATGGGGATGTGGTTAATGTGCATGACTGGTATCAGTCATTTAAGTCCATCGTGCTTTCCATGCATACCCTTGCAAAGAAAGGG
AAATCGAAGTCAAAGCGTTCTTCGCCATCGCCAAAGAAAGGAAAGATCACAACAAATGAACCTGCAAAGCCAAGTGAAGCTTCCATTCTAGCAAGGTTCT
GCAAAGCGATAGTGGAGCTTCAAGTAACAGGACTTGTTAAGATGCCCAGCAGAAGACGCCCAGATTACTTGCAGAGACTTGCTTTCGGGTTGTAA
AA sequence
>Lus10021778 pacid=23159363 polypeptide=Lus10021778 locus=Lus10021778.g ID=Lus10021778.BGIv1.0 annot-version=v1.0
MCPVECVAFHEVVCFNGVDKLQASLVGDTRRRIQVDFQKFHDIIRCSCCQKRGSTLLPSMPDSSIMYSLAQEHGDVVNVHDWYQSFKSIVLSMHTLAKKG
KSKSKRSSPSPKKGKITTNEPAKPSEASILARFCKAIVELQVTGLVKMPSRRRPDYLQRLAFGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16690 ORC3, ATORC3 origin recognition complex sub... Lus10021778 0 1
AT2G24960 unknown protein Lus10042715 7.0 0.9290
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10009129 11.3 0.8635
Lus10004506 12.5 0.7012
AT5G51105 Protein of unknown function (D... Lus10043285 13.9 0.8613
AT1G21130 IGMT4 indole glucosinolate O-methylt... Lus10030187 16.4 0.8538
Lus10028570 18.7 0.8431
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10029435 20.5 0.8431
AT3G47570 Leucine-rich repeat protein ki... Lus10030633 22.1 0.8431
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10030693 23.7 0.8431
Lus10024141 25.1 0.8431

Lus10021778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.