Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040129 [exp] 148 / 9e-47 ND / Lus10022515 [exp] 133 / 1e-39 ND 38 / 0.008 Lus10004526 [exp] 129 / 6e-38 AT3G52490 75 / 1e-14 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10017887 [exp] 121 / 6e-37 ND / Lus10042943 [exp] 120 / 8e-36 ND 40 / 3e-04 Lus10032568 [exp] 97 / 1e-26 ND / Lus10036305 [exp] 90 / 7e-24 ND / Lus10038590 [exp] 83 / 2e-21 ND / Lus10006014 [exp] 63 / 2e-14 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021782 pacid=23159332 polypeptide=Lus10021782 locus=Lus10021782.g ID=Lus10021782.BGIv1.0 annot-version=v1.0 ATGACAGCTATGTATGATGGCTCTGCTGGGGATGACGACGATGATGAGAATAGGAATCCTTTGAAGGAGAAGAGGGACTCATGGAACTATTATATGATCG AAGGTCGCCTCTTTGAGAAGAGCTTGAAGACTCGTAGATGGAGTGTATTGGGTCGAGACGACTCAAGGGTGGTGTTGGAGTTACACAAGTATGGGGTGCC TATCGGCGAGGAGGGATGCTTCCTACGGCAAGTAAATAGGAAACTAGTGAAGAATAAAAAATTCGATATTGGTGTAAAAAACTGGCATAAGGTCACCAAA GTGGAGAAGGATCACGTGTTCTAG
AA sequence Show only first row Show all	>Lus10021782 pacid=23159332 polypeptide=Lus10021782 locus=Lus10021782.g ID=Lus10021782.BGIv1.0 annot-version=v1.0 MTAMYDGSAGDDDDDENRNPLKEKRDSWNYYMIEGRLFEKSLKTRRWSVLGRDDSRVVLELHKYGVPIGEEGCFLRQVNRKLVKNKKFDIGVKNWHKVTK VEKDHVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021782 [exp]	0	1
					Lus10007927 [exp]	1.0	1.0000
					Lus10023587 [exp]	1.4	1.0000
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	1.7	1.0000
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	2.0	1.0000
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	2.2	1.0000
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10039026 [exp]	2.4	1.0000
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10042202 [exp]	2.6	1.0000
AT1G24735			S-adenosyl-L-methionine-depend...		Lus10021804 [exp]	3.5	0.9983
AT5G45650			subtilase family protein (.1)		Lus10026062 [exp]	3.6	0.9977
AT5G42230		SCPL41	serine carboxypeptidase-like 4...		Lus10023444 [exp]	4.4	0.9774

Compare expression of checked genes

Lus10021782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.