Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23220 172 / 3e-56 Dynein light chain type 1 family protein (.1) AT5G20110 124 / 2e-36 Dynein light chain type 1 family protein (.1) AT3G16120 79 / 8e-20 Dynein light chain type 1 family protein (.1) AT1G52240 76 / 5e-19 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT4G27360 74 / 7e-18 Dynein light chain type 1 family protein (.1) AT4G15930 71 / 1e-16 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034609 [exp] 241 / 2e-83 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10031734 [exp] 109 / 7e-32 AT1G23220 100 / 6e-29 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 103 / 3e-28 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 103 / 6e-28 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10004252 [exp] 107 / 1e-27 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10025794 [exp] 81 / 1e-20 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 78 / 1e-19 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 70 / 2e-16 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 70 / 4e-16 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G108700 [exp] 194 / 7e-65 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 189 / 6e-63 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 116 / 7e-34 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 119 / 2e-33 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.001G124700 [exp] 114 / 5e-33 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 113 / 1e-32 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 107 / 1e-30 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1) Potri.003G052800 [exp] 76 / 9e-19 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 74 / 6e-18 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 74 / 1e-17 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10021793 pacid=23159331 polypeptide=Lus10021793 locus=Lus10021793.g ID=Lus10021793.BGIv1.0 annot-version=v1.0 ATGATGGACGATGCACAGCTGGAACTGGAGAGGAGGAGCAAGTTCTTGAGCAGCTTGATCCAGAAAAAGAAAGCCAACATTCCCCAAGACCAAGACCAAG ACCAAGACCAAGACAACCAGGTGGAAGGGTTCAATGTGAGAGTTAGAGCTTCTGATATGCCCATTGCTCTCCAGACAAAGGCATTCACTTGTGCTCGTCA CCAGCTTGACTCCATGCCTCCCAAGAAGCTTGACAGTAAGCAACTTGCACTCGCCCTCAAAAAGGAATTTGATTCTGCGTACGGTCCAGCTTGGCACTGC ATAGTTGGGACAAGCTTTGGTTCATATGTCACTCATTCAGTAGGAGGCTTTCTCTACTTCTCCATCGACGGCAAGCTTTTCGTTCTCCTCTTTAAGACTG CCGTTGAGCCTTTTCATCGCTCGCTCTGA
AA sequence Show only first row Show all	>Lus10021793 pacid=23159331 polypeptide=Lus10021793 locus=Lus10021793.g ID=Lus10021793.BGIv1.0 annot-version=v1.0 MMDDAQLELERRSKFLSSLIQKKKANIPQDQDQDQDQDNQVEGFNVRVRASDMPIALQTKAFTCARHQLDSMPPKKLDSKQLALALKKEFDSAYGPAWHC IVGTSFGSYVTHSVGGFLYFSIDGKLFVLLFKTAVEPFHRSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23220			Dynein light chain type 1 fami...		Lus10021793 [exp]	0	1
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10034690 [exp]	2.0	0.9490
AT5G39760	ZF_HD	ATHB23, ZHD10	ZINC FINGER HOMEODOMAIN 10, ho...		Lus10030473 [exp]	5.1	0.9498
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10021619 [exp]	6.3	0.9161
AT1G05490		CHR31	chromatin remodeling 31 (.1)		Lus10011033 [exp]	8.1	0.9205
AT1G53520			Chalcone-flavanone isomerase f...		Lus10026174 [exp]	8.3	0.9133
AT2G45850	AT-hook		AT hook motif DNA-binding fami...		Lus10037858 [exp]	12.8	0.9058
AT2G18350	ZF_HD	ATHB24, ZHD6	ZINC FINGER HOMEODOMAIN 6, hom...		Lus10007147 [exp]	13.4	0.9433
AT4G39260		ATGRP8, CCR1, G...	glycine-rich RNA-binding prote...		Lus10001242 [exp]	14.2	0.8940
AT2G24440			selenium binding (.1)		Lus10026958 [exp]	15.5	0.9345
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10003141 [exp]	15.9	0.9356

Compare expression of checked genes

Lus10021793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.