Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66150 156 / 2e-45 TMK1 transmembrane kinase 1 (.1) AT1G24650 116 / 3e-31 Leucine-rich repeat protein kinase family protein (.1) AT2G01820 107 / 5e-28 CYCJ18 Leucine-rich repeat protein kinase family protein (.1) AT3G23750 74 / 2e-16 Leucine-rich repeat protein kinase family protein (.1) AT1G10850 66 / 1e-13 Leucine-rich repeat protein kinase family protein (.1) AT1G60630 62 / 2e-12 Leucine-rich repeat protein kinase family protein (.1) AT5G21090 58 / 3e-11 Leucine-rich repeat (LRR) family protein (.1) AT1G09970 58 / 1e-10 RLK7, LRRXI-23 ,LRR XI-23 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) AT1G66830 58 / 1e-10 Leucine-rich repeat protein kinase family protein (.1) AT5G67280 56 / 4e-10 RLK receptor-like kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039038 [exp] 199 / 3e-60 AT1G66150 1356 / 0.0 transmembrane kinase 1 (.1) Lus10027336 [exp] 196 / 4e-59 AT1G66150 1348 / 0.0 transmembrane kinase 1 (.1) Lus10003807 [exp] 145 / 3e-41 AT1G66150 1221 / 0.0 transmembrane kinase 1 (.1) Lus10019131 [exp] 110 / 5e-29 AT1G66150 981 / 0.0 transmembrane kinase 1 (.1) Lus10034432 [exp] 103 / 9e-27 AT1G66150 979 / 0.0 transmembrane kinase 1 (.1) Lus10035104 [exp] 93 / 4e-23 AT2G01820 452 / 2e-149 Leucine-rich repeat protein kinase family protein (.1) Lus10031944 [exp] 93 / 8e-23 AT2G01820 1008 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10016952 [exp] 87 / 1e-20 AT1G66150 806 / 0.0 transmembrane kinase 1 (.1) Lus10021275 [exp] 86 / 1e-20 AT1G66150 804 / 0.0 transmembrane kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G084000 [exp] 153 / 3e-44 AT1G66150 730 / 0.0 transmembrane kinase 1 (.1) Potri.017G134900 [exp] 152 / 5e-44 AT1G66150 1333 / 0.0 transmembrane kinase 1 (.1) Potri.010G103000 [exp] 132 / 1e-36 AT2G01820 1050 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G137801 [exp] 114 / 2e-30 AT1G66150 1101 / 0.0 transmembrane kinase 1 (.1) Potri.006G203500 [exp] 90 / 7e-22 AT2G01820 528 / 5e-173 Leucine-rich repeat protein kinase family protein (.1) Potri.016G070500 [exp] 86 / 1e-20 AT1G66150 778 / 0.0 transmembrane kinase 1 (.1) Potri.001G217700 [exp] 77 / 2e-17 AT1G66150 724 / 0.0 transmembrane kinase 1 (.1) Potri.013G035900 [exp] 77 / 3e-17 AT3G23750 1044 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.009G020400 [exp] 75 / 1e-16 AT1G66150 511 / 5e-166 transmembrane kinase 1 (.1) Potri.005G049200 [exp] 72 / 7e-16 AT3G23750 589 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat CL0022 [flax] [poplar] PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10021795 pacid=23159301 polypeptide=Lus10021795 locus=Lus10021795.g ID=Lus10021795.BGIv1.0 annot-version=v1.0 ATGCTCCAGCAATGTTTGCTCTCAACCGAAGATGCTCCAGCAATGTTTGCTCTCAAGGAGTCCCTAAACCCTCCAGCCATACTCGGATGGTCCGACTCGA ATCCTTGCAAATGGGATCACGTCACCCGCATCCAAATCGGCTACCAGCAGCTCAAGGGCAGTCTCCCACCAGATCTTCAAAACCTCACCCAGCTCGAAAG GCTAGAGGTTCAATCGAACAGCATTTCTGGTCCTCTCCCCACTCTATCCGGATTCAGGTCGCTCCAGGTCGTGATGTTGAGTGACAACCTCTTCGATTCA ATCCCTCCTGACTTCTTCCAAGGTTTAACCTCTCTTCAAGTTATGGAAACCGACAACAACCCATTTGACAGCTAG
AA sequence Show only first row Show all	>Lus10021795 pacid=23159301 polypeptide=Lus10021795 locus=Lus10021795.g ID=Lus10021795.BGIv1.0 annot-version=v1.0 MLQQCLLSTEDAPAMFALKESLNPPAILGWSDSNPCKWDHVTRIQIGYQQLKGSLPPDLQNLTQLERLEVQSNSISGPLPTLSGFRSLQVVMLSDNLFDS IPPDFFQGLTSLQVMETDNNPFDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10021795 [exp]	0	1
AT3G22250			UDP-Glycosyltransferase superf...		Lus10035452 [exp]	2.0	0.8409
AT3G06120	bHLH	MUTE, bHLH045	MUTE, basic helix-loop-helix (...		Lus10010503 [exp]	8.6	0.7992
AT5G19580			glyoxal oxidase-related protei...		Lus10043231 [exp]	20.2	0.6935
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10000433 [exp]	24.8	0.6756
					Lus10007128 [exp]	29.9	0.7043
AT2G27550		ATC	centroradialis (.1)		Lus10020600 [exp]	36.5	0.6942
AT5G19875			unknown protein		Lus10006311 [exp]	54.2	0.6940
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Lus10042450 [exp]	59.0	0.6162
AT2G40435			unknown protein		Lus10010217 [exp]	63.0	0.6798
AT5G19370			rhodanese-like domain-containi...		Lus10026105 [exp]	63.4	0.6833

Compare expression of checked genes

Lus10021795 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.