Lus10021804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67980 190 / 2e-61 CCOAMT caffeoyl-CoA 3-O-methyltransferase (.1.2)
AT1G67990 171 / 5e-54 ATTSM1 TAPETUM-SPECIFIC METHYLTRANSFERASE 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G24735 162 / 3e-50 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
AT4G26220 120 / 4e-34 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT4G34050 102 / 6e-28 CCoAOMT1 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
AT3G61990 92 / 1e-22 OMTF3 O-MTase family 3 protein, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT3G62000 87 / 1e-20 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034584 187 / 5e-60 AT1G67980 299 / 2e-103 caffeoyl-CoA 3-O-methyltransferase (.1.2)
Lus10014074 105 / 4e-28 AT4G34050 465 / 1e-168 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10027888 105 / 5e-28 AT4G34050 461 / 9e-167 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10002837 105 / 5e-28 AT4G34050 462 / 2e-167 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10019841 105 / 6e-28 AT4G34050 466 / 8e-169 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10009484 103 / 3e-26 AT4G26220 255 / 1e-83 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036339 80 / 5e-18 AT3G62000 385 / 9e-136 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10010276 77 / 2e-17 AT3G62000 269 / 1e-90 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10032698 44 / 1e-05 ND 134 / 1e-40
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G104400 201 / 2e-65 AT1G67980 335 / 6e-118 caffeoyl-CoA 3-O-methyltransferase (.1.2)
Potri.008G136600 137 / 2e-40 AT1G67980 337 / 1e-118 caffeoyl-CoA 3-O-methyltransferase (.1.2)
Potri.018G070300 116 / 2e-32 AT4G26220 325 / 1e-113 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.001G304800 108 / 5e-29 AT4G34050 455 / 1e-164 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Potri.009G099800 106 / 2e-28 AT4G34050 465 / 2e-168 caffeoyl coenzyme A O-methyltransferase 1, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Potri.002G183600 80 / 5e-18 AT3G62000 404 / 3e-143 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF01596 Methyltransf_3 O-methyltransferase
Representative CDS sequence
>Lus10021804 pacid=23159339 polypeptide=Lus10021804 locus=Lus10021804.g ID=Lus10021804.BGIv1.0 annot-version=v1.0
ATGGACTTGCCACACAAAGGAATCCTCCAGAGCCCTGACCTCGCAAAGTATATATATGAAACAAGCGTATATCCAAGAGAACATGAGCAATTGATGAAAA
TACTGGAAGCTACCGTAGCCCAATACGGCAACATGGCGGAGAAGGTGGTGCCGGTGGATGAAGGGAGATTCTTGTCGCTGTTAGTGAAGCTTTTGAACCT
AAAGAGGACGCTTGAGATTGGTGTTTTCACCGGCTACTCCCTTCTTTCCACCGCCTTAGCCCTTTCTGACGATGCTCTGGGAGAGGAAGCATTGTATGAC
TTTGCATTCGTGGACGCAGACAAACCGAGCTACAAGGACTACCACGAGCAGCTGGTGAAGCTGGTGAAGGTCGGAGGCTTGATCGCCTACGACAACACTC
TCTGGTTCGGATTCGTTGCCAAGGATGAGGGTGAGGTCCCGGAGCGGTTCAGGGGTGATAGGAAGGACATCATGGAGCTGAACAAGGTATTGGCTACCGA
TCCGAGGGTGGATGTTGCTCAGATTTCTGTGGGAGATGGGATCACTTTGTGCAGGCGGATTCTGTAG
AA sequence
>Lus10021804 pacid=23159339 polypeptide=Lus10021804 locus=Lus10021804.g ID=Lus10021804.BGIv1.0 annot-version=v1.0
MDLPHKGILQSPDLAKYIYETSVYPREHEQLMKILEATVAQYGNMAEKVVPVDEGRFLSLLVKLLNLKRTLEIGVFTGYSLLSTALALSDDALGEEALYD
FAFVDADKPSYKDYHEQLVKLVKVGGLIAYDNTLWFGFVAKDEGEVPERFRGDRKDIMELNKVLATDPRVDVAQISVGDGITLCRRIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24735 S-adenosyl-L-methionine-depend... Lus10021804 0 1
Lus10021782 3.5 0.9983
AT1G33530 F-box family protein (.1) Lus10014984 4.9 0.9659
Lus10023587 4.9 0.9983
AT3G29410 AtTPS25 Terpenoid cyclases/Protein pre... Lus10038330 5.5 0.9505
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 6.0 0.9983
AT3G19540 Protein of unknown function (D... Lus10028040 6.9 0.9983
AT1G67623 F-box family protein (.1) Lus10030790 7.0 0.8960
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 7.7 0.9983
AT4G29250 HXXXD-type acyl-transferase fa... Lus10028335 8.1 0.9407
Lus10007927 8.5 0.9983

Lus10021804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.