Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42290 74 / 2e-18 transcription activator-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034574 [exp] 0 / 1 AT5G42290 42 / 1e-09 transcription activator-related (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021820 pacid=23159330 polypeptide=Lus10021820 locus=Lus10021820.g ID=Lus10021820.BGIv1.0 annot-version=v1.0 ATGAAGAAACGAGATGGCGTGGAGGAGCGAGGGAAAAGGGAAGAGACGAAGCCGACGGTGAATCAAATGACGGAGATGAAGCCAGTGACTAAGGAAGCAT ACGGCGGTGGAATGTACGCAAACGAAAAGGAAGCCAAAACACAACATCAGGGACAGCAGCAGCGGGCAAGCGATACGCAGAGTGCCGACGGTCCGGTAGA GGAGTCAAGGGAGCTGAAGCATCCTCCGCCGCCGTCCACAGGGGATCGGGACTTGGATATCACCGGCATGTCTTACATCCAGTAG
AA sequence Show only first row Show all	>Lus10021820 pacid=23159330 polypeptide=Lus10021820 locus=Lus10021820.g ID=Lus10021820.BGIv1.0 annot-version=v1.0 MKKRDGVEERGKREETKPTVNQMTEMKPVTKEAYGGGMYANEKEAKTQHQGQQQRASDTQSADGPVEESRELKHPPPPSTGDRDLDITGMSYIQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42290			transcription activator-relate...		Lus10021820 [exp]	0	1
					Lus10023763 [exp]	1.0	0.9353
AT1G69210			Uncharacterised protein family...		Lus10014566 [exp]	6.2	0.7850
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10029233 [exp]	11.8	0.7663
AT5G23510			unknown protein		Lus10029154 [exp]	14.1	0.8020
AT4G10790			UBX domain-containing protein ...		Lus10039951 [exp]	18.2	0.8079
AT1G24620			EF hand calcium-binding protei...		Lus10029660 [exp]	18.2	0.7088
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	21.3	0.8071
					Lus10017955 [exp]	25.6	0.8070
AT1G03670			ankyrin repeat family protein ...		Lus10013878 [exp]	28.2	0.6578
AT2G24960			unknown protein		Lus10042421 [exp]	31.0	0.7993

Compare expression of checked genes

Lus10021820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.