Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28630 117 / 8e-32 KCS12 3-ketoacyl-CoA synthase 12 (.1) AT1G07720 114 / 8e-31 KCS3 3-ketoacyl-CoA synthase 3 (.1) AT5G04530 81 / 5e-19 KCS19 3-ketoacyl-CoA synthase 19 (.1) AT1G25450 73 / 6e-16 KCS5, CER60 ECERIFERUM 60, 3-ketoacyl-CoA synthase 5 (.1) AT4G34520 72 / 1e-15 KCS18, FAE1 FATTY ACID ELONGATION1, 3-ketoacyl-CoA synthase 18 (.1) AT2G15090 72 / 1e-15 KCS8 3-ketoacyl-CoA synthase 8 (.1) AT1G19440 71 / 2e-15 KCS4 3-ketoacyl-CoA synthase 4 (.1) AT1G01120 71 / 2e-15 KCS1 3-ketoacyl-CoA synthase 1 (.1) AT1G71160 71 / 3e-15 KCS7 3-ketoacyl-CoA synthase 7 (.1) AT4G34250 69 / 9e-15 KCS16 3-ketoacyl-CoA synthase 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040873 [exp] 145 / 4e-43 AT2G28630 546 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10004918 [exp] 142 / 1e-41 AT2G28630 560 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10015222 [exp] 113 / 2e-30 AT2G28630 654 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10005434 [exp] 112 / 5e-30 AT2G28630 664 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10040333 [exp] 79 / 3e-18 AT5G04530 611 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10023458 [exp] 77 / 1e-17 AT5G04530 605 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10039401 [exp] 74 / 2e-16 AT1G04220 644 / 0.0 3-ketoacyl-CoA synthase 2 (.1) Lus10039906 [exp] 74 / 4e-16 AT5G04530 497 / 1e-172 3-ketoacyl-CoA synthase 19 (.1) Lus10039399 [exp] 71 / 2e-15 AT1G04220 689 / 0.0 3-ketoacyl-CoA synthase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G026800 [exp] 126 / 2e-35 AT2G28630 660 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.001G234500 [exp] 105 / 8e-28 AT2G28630 647 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.010G212600 [exp] 87 / 7e-21 AT5G04530 576 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G119600 [exp] 82 / 3e-19 AT5G04530 561 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G120100 [exp] 81 / 7e-19 AT5G04530 543 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G119800 [exp] 80 / 2e-18 AT5G04530 558 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.008G048500 [exp] 77 / 9e-18 AT5G04530 337 / 2e-113 3-ketoacyl-CoA synthase 19 (.1) Potri.013G015100 [exp] 75 / 1e-16 AT1G71160 486 / 6e-170 3-ketoacyl-CoA synthase 7 (.1) Potri.009G116700 [exp] 72 / 8e-16 AT1G19440 899 / 0.0 3-ketoacyl-CoA synthase 4 (.1) Potri.008G160000 [exp] 72 / 1e-15 AT2G26640 821 / 0.0 3-ketoacyl-CoA synthase 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0046 [flax] [poplar] Thiolase PF08392 [flax] [poplar] FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein
Representative CDS sequence Show only first row Show all	>Lus10021821 pacid=23159344 polypeptide=Lus10021821 locus=Lus10021821.g ID=Lus10021821.BGIv1.0 annot-version=v1.0 ATGATTTTGGCTAACTGTCTGTTCAGGACTGGTGGATGTGCGATTCTGTTGACGAACAAGCCGGAGCTGAAGAACCGTGCGATGTACAAGCTCAAGACTC TGGTTAGGACTCACCATGGAAACAGAGACGAGTCATTTGGTAGCTGCATCCAGAAGGAGGACGAGCAAGGCAGATTAGGTTTCCATTTGGGGAAAACTTT GCCAAATTGCAGCCACCAGGGCATTTGTCGACAATCTAAAGGAGAGTTCGCCAAAGTTCCTTCCGGTGAGGGAGCTCATCAGGTTCTTGTTCGTTTACTC GATGAGGAAGCTCACGAAACGCGTCGGCGGTGGAGGCGGCGGCAGCAAGCCACCGCTGCCTCTGCCGCCGGTGATTAA
AA sequence Show only first row Show all	>Lus10021821 pacid=23159344 polypeptide=Lus10021821 locus=Lus10021821.g ID=Lus10021821.BGIv1.0 annot-version=v1.0 MILANCLFRTGGCAILLTNKPELKNRAMYKLKTLVRTHHGNRDESFGSCIQKEDEQGRLGFHLGKTLPNCSHQGICRQSKGEFAKVPSGEGAHQVLVRLL DEEAHETRRRWRRRQQATAASAAGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10021821 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	4.4	0.7883
AT1G03890			RmlC-like cupins superfamily p...		Lus10033893 [exp]	5.3	0.7773
					Lus10028940 [exp]	7.5	0.7714
					Lus10033191 [exp]	16.1	0.7003
AT4G35160			O-methyltransferase family pro...		Lus10024678 [exp]	20.3	0.6431
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007853 [exp]	37.7	0.6434
AT3G10660		ATCPK2, CPK2	calmodulin-domain protein kina...		Lus10016190 [exp]	40.2	0.6106
AT1G53240		mMDH1	mitochondrial malate dehydroge...		Lus10036186 [exp]	41.2	0.5604
					Lus10003927 [exp]	47.0	0.5854
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10031166 [exp]	51.2	0.5858

Compare expression of checked genes

Lus10021821 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.