Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66160 56 / 6e-10 ATCMPG1 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2) AT5G37490 47 / 5e-07 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004189 [exp] 162 / 6e-53 AT1G66160 75 / 7e-17 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2) Lus10040125 [exp] 42 / 4e-05 AT3G02840 164 / 1e-48 ARM repeat superfamily protein (.1) Lus10001079 [exp] 0 / 1 AT5G37490 290 / 1e-93 ARM repeat superfamily protein (.1) Lus10040124 [exp] 0 / 1 AT1G66160 154 / 6e-45 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G042600 [exp] 87 / 4e-21 AT5G37490 294 / 2e-95 ARM repeat superfamily protein (.1) Potri.015G031000 [exp] 77 / 1e-17 AT5G37490 323 / 9e-107 ARM repeat superfamily protein (.1) Potri.017G135000 [exp] 67 / 5e-14 AT5G37490 375 / 4e-127 ARM repeat superfamily protein (.1) Potri.004G083900 [exp] 61 / 1e-11 AT5G37490 354 / 8e-119 ARM repeat superfamily protein (.1) Potri.008G137700 [exp] 49 / 2e-07 AT5G37490 333 / 9e-111 ARM repeat superfamily protein (.1) Potri.010G103100 [exp] 43 / 2e-05 AT5G37490 315 / 1e-103 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021822 pacid=23159334 polypeptide=Lus10021822 locus=Lus10021822.g ID=Lus10021822.BGIv1.0 annot-version=v1.0 ATGCCCAGCCACCAATCAGACTCTCCTCAGCTTCGATTTGGTACCCAATCACTCTCTCCATCGTATGATTCAAGACTGGTGCGTTCAGAACGGCAGATTT CCTCCTCTCAAATCTCTATCGTCCTCCGGTTGGAGGATTCTACCGCGAGATCGAACCTATCGGAGACCTTGGACTCCTTGCGTAAGATTAATAGCTGGGG GAACGAGAGCGAGAGGAATCGATTGTGTATTGTCTCTGCTGGAGCCGCCGCCGTCCTCGTAACTGCGTTTGACGGATTTGCCGTCGGAGTACTTGAGCAG CTACTAGCTTTGATTAGCTGGATGCTTCCCATCATCGACGCTGAAGCTCTCGGGCGATTGGGATCGCCAGAGTCGGTGAAAGCACTAGTCTAA
AA sequence Show only first row Show all	>Lus10021822 pacid=23159334 polypeptide=Lus10021822 locus=Lus10021822.g ID=Lus10021822.BGIv1.0 annot-version=v1.0 MPSHQSDSPQLRFGTQSLSPSYDSRLVRSERQISSSQISIVLRLEDSTARSNLSETLDSLRKINSWGNESERNRLCIVSAGAAAVLVTAFDGFAVGVLEQ LLALISWMLPIIDAEALGRLGSPESVKALV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02840			ARM repeat superfamily protein...		Lus10021822 [exp]	0	1
AT4G26220			S-adenosyl-L-methionine-depend...		Lus10009484 [exp]	8.1	0.7913
					Lus10040046 [exp]	15.0	0.8146
					Lus10000359 [exp]	15.5	0.8018
					Lus10016322 [exp]	18.1	0.7923
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10009017 [exp]	72.7	0.7525
AT5G19960			RNA-binding (RRM/RBD/RNP motif...		Lus10017757 [exp]	118.4	0.7496
AT1G13030			sphere organelles protein-rela...		Lus10006465 [exp]	154.6	0.7214
AT4G10540			Subtilase family protein (.1)		Lus10031097 [exp]	168.2	0.7135
					Lus10014982 [exp]	168.9	0.7097
AT5G27430			Signal peptidase subunit (.1)		Lus10040138 [exp]	288.5	0.7003

Compare expression of checked genes

Lus10021822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.