Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20470 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) AT1G76190 99 / 4e-28 SAUR-like auxin-responsive protein family (.1) AT4G34780 64 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT4G34770 61 / 4e-13 SAUR-like auxin-responsive protein family (.1) AT4G34750 61 / 1e-12 SAUR-like auxin-responsive protein family (.1.2) AT4G34800 59 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT4G13790 59 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT3G61900 59 / 3e-12 SAUR-like auxin-responsive protein family (.1) AT5G10990 59 / 4e-12 SAUR-like auxin-responsive protein family (.1) AT2G28085 58 / 6e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034570 [exp] 182 / 3e-61 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10025114 [exp] 69 / 6e-16 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1) Lus10023970 [exp] 69 / 1e-15 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 67 / 1e-15 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 67 / 2e-15 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 65 / 1e-14 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10025115 [exp] 64 / 5e-14 AT1G29430 88 / 6e-23 SAUR-like auxin-responsive protein family (.1) Lus10023969 [exp] 64 / 7e-14 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 62 / 1e-13 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G181400 [exp] 72 / 2e-17 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 72 / 4e-17 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141251 [exp] 72 / 4e-17 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.017G043400 [exp] 70 / 2e-16 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 69 / 8e-16 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 67 / 4e-15 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 67 / 4e-15 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.002G064300 [exp] 67 / 5e-15 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 67 / 5e-15 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 64 / 3e-14 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10021825 pacid=23159350 polypeptide=Lus10021825 locus=Lus10021825.g ID=Lus10021825.BGIv1.0 annot-version=v1.0 ATGATGCTAAAGCAATGGAGCAGCAGGAAGAAGAAGAACGGCCATTTCGCAGTGTACACAAAAGAAGGCAAGAGGTTCACTGTCCCACTCTGCTACCTGA ACCACCCCATCTTCCGAGTCTTGCTGGAGATGGCCGAGGAAGAGTTGGGGACTACGGCTGCTGGCCCCATCCAAGTGCCCTGCGAGGAAGAACTCATGGT CTCCATTCTTTCTCTGTTGAGGAAAGAAGGAAATATTGCTGATGATGATCATGTTTCCTCCTCCATAAGCAGCAGCAGCTGTAATGGTGGTTCTTCATTG GCTGCTATCTTCTTAACCCTTCACTCCCAGTTCAGTTCTTAG
AA sequence Show only first row Show all	>Lus10021825 pacid=23159350 polypeptide=Lus10021825 locus=Lus10021825.g ID=Lus10021825.BGIv1.0 annot-version=v1.0 MMLKQWSSRKKKNGHFAVYTKEGKRFTVPLCYLNHPIFRVLLEMAEEELGTTAAGPIQVPCEEELMVSILSLLRKEGNIADDDHVSSSISSSSCNGGSSL AAIFLTLHSQFSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76190			SAUR-like auxin-responsive pro...		Lus10021825 [exp]	0	1
AT1G59640	bHLH	ZCW32, bHLH031...	BIG PETAL UB, BIG PETAL P (.1....		Lus10030807 [exp]	1.4	0.7932
AT5G66440			unknown protein		Lus10024273 [exp]	3.7	0.6991
AT3G60320			Protein of unknown function (D...		Lus10028207 [exp]	8.8	0.7033
AT1G23965			unknown protein		Lus10030641 [exp]	10.4	0.7651
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10036827 [exp]	11.6	0.7149
AT1G74160			unknown protein		Lus10034678 [exp]	15.1	0.7448
AT5G62350			Plant invertase/pectin methyle...		Lus10027198 [exp]	17.2	0.7462
AT4G29310			Protein of unknown function (D...		Lus10034991 [exp]	23.5	0.7186
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10025231 [exp]	24.0	0.7161
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008996 [exp]	24.0	0.7214

Compare expression of checked genes

Lus10021825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.