Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20460 50 / 6e-10 unknown protein AT1G76185 50 / 9e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034569 [exp] 51 / 5e-10 AT1G20460 154 / 5e-50 unknown protein Lus10012282 [exp] 50 / 9e-10 AT1G20460 159 / 2e-52 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G013000 [exp] 48 / 4e-09 AT1G20460 103 / 4e-30 unknown protein Potri.005G248300 [exp] 48 / 6e-09 AT1G20460 101 / 2e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021826 pacid=23159349 polypeptide=Lus10021826 locus=Lus10021826.g ID=Lus10021826.BGIv1.0 annot-version=v1.0 ATGATCACGAGATCGAATCTGGCCGAGCAGTTGAGGGACTACCAGATACGATCCAAGCATGATTGGTCCTCCGTTTCCTTCTTTTCGTCCTCCTCTTCCT CCACAAACAACACCTCCAGTCAATCGAGGCATGCTGGTGTTACACAGAATGCTGCATGCGTTCGTGATGACTGA
AA sequence Show only first row Show all	>Lus10021826 pacid=23159349 polypeptide=Lus10021826 locus=Lus10021826.g ID=Lus10021826.BGIv1.0 annot-version=v1.0 MITRSNLAEQLRDYQIRSKHDWSSVSFFSSSSSSTNNTSSQSRHAGVTQNAACVRDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20460			unknown protein		Lus10021826 [exp]	0	1
AT5G58190		ECT10	evolutionarily conserved C-ter...		Lus10027582 [exp]	7.5	0.7426
AT3G55270		MKP1, ATMKP1	ARABIDOPSIS MITOGEN-ACTIVATED ...		Lus10003291 [exp]	9.2	0.8028
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10002597 [exp]	15.2	0.7250
AT1G68490			unknown protein		Lus10034327 [exp]	19.3	0.7185
AT4G32350			Regulator of Vps4 activity in ...		Lus10023635 [exp]	24.0	0.7249
AT5G57190		PSD2	phosphatidylserine decarboxyla...		Lus10009324 [exp]	28.2	0.7318
AT3G12590			unknown protein		Lus10001698 [exp]	40.5	0.7243
AT1G71090			Auxin efflux carrier family pr...		Lus10016705 [exp]	41.2	0.7178
AT5G27860			unknown protein		Lus10020665 [exp]	44.7	0.7133
AT1G24160			unknown protein		Lus10029213 [exp]	54.7	0.6933

Compare expression of checked genes

Lus10021826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.