Lus10021831 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20430 111 / 4e-33 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034561 205 / 4e-70 AT1G20430 108 / 5e-32 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G013601 131 / 4e-41 AT1G20430 122 / 1e-37 unknown protein
PFAM info
Representative CDS sequence
>Lus10021831 pacid=23159341 polypeptide=Lus10021831 locus=Lus10021831.g ID=Lus10021831.BGIv1.0 annot-version=v1.0
ATGGCTTCCACTGGCTCAGCAGCTGACGCCCAAAACCCTAGACAAGCTACAGGCTTCCTAGCAAACGCCATCAAGCGGAAACACAGTTTTATCCAGTTTG
CCGCGATGACGGGGATCCTGCTTCTCAGCGTTAGATCGCTGGGGCAGAAGTACCGAATCCATGACCTTGAGGATGATACTTCGGCTCTCAAGGAGGAGCA
GCAGACGCTCTCTGACCGAATGAAGAACATCAAAGAAGCTTTGTTGCAGGAAGCGTCTCACGAGCCTACCGGCCGATTCGCCACACGCCTTGGCAGTCTC
TTCAGCGAGCAAGACTCGAACTAA
AA sequence
>Lus10021831 pacid=23159341 polypeptide=Lus10021831 locus=Lus10021831.g ID=Lus10021831.BGIv1.0 annot-version=v1.0
MASTGSAADAQNPRQATGFLANAIKRKHSFIQFAAMTGILLLSVRSLGQKYRIHDLEDDTSALKEEQQTLSDRMKNIKEALLQEASHEPTGRFATRLGSL
FSEQDSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20430 unknown protein Lus10021831 0 1
AT5G49210 unknown protein Lus10036792 11.3 0.7977
AT2G36130 Cyclophilin-like peptidyl-prol... Lus10017010 13.0 0.8250
AT2G04630 NRPE6B, NRPB6B RNA polymerase Rpb6 (.1) Lus10015000 13.8 0.8297
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10029155 16.8 0.8030
AT1G07170 PHF5-like protein (.1.2.3) Lus10040654 16.9 0.8036
AT5G16950 unknown protein Lus10021093 25.9 0.8126
AT5G64180 unknown protein Lus10008120 33.1 0.7806
AT2G28910 CXIP4 CAX interacting protein 4 (.1) Lus10004961 34.6 0.7829
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10011957 35.3 0.8007
AT3G61540 alpha/beta-Hydrolases superfam... Lus10010141 42.7 0.7700

Lus10021831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.