Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76140 67 / 4e-15 Prolyl oligopeptidase family protein (.1.2) AT1G20380 62 / 3e-13 Prolyl oligopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034556 [exp] 92 / 2e-23 AT1G76140 1056 / 0.0 Prolyl oligopeptidase family protein (.1.2) Lus10034558 [exp] 89 / 9e-23 AT1G76140 565 / 0.0 Prolyl oligopeptidase family protein (.1.2) Lus10019994 [exp] 79 / 4e-19 AT1G76140 1008 / 0.0 Prolyl oligopeptidase family protein (.1.2) Lus10021235 [exp] 72 / 1e-16 AT1G76140 1184 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G014000 [exp] 71 / 3e-16 AT1G76140 1217 / 0.0 Prolyl oligopeptidase family protein (.1.2) Potri.002G013900 [exp] 70 / 4e-16 AT1G76140 1165 / 0.0 Prolyl oligopeptidase family protein (.1.2) Potri.005G247300 [exp] 69 / 1e-15 AT1G76140 1206 / 0.0 Prolyl oligopeptidase family protein (.1.2) Potri.005G247400 [exp] 69 / 2e-15 AT1G76140 1210 / 0.0 Prolyl oligopeptidase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021834 pacid=23159343 polypeptide=Lus10021834 locus=Lus10021834.g ID=Lus10021834.BGIv1.0 annot-version=v1.0 ATGCAGACGTTGCAGAGTGTTCTGATCACCAGCTTGGAGAAGAGTCCCCAAACCAACCCTATAATTGGCCGGGTTGATAAGAAATCCGGCCATGGCTTTG GCCGTCCCACTCAAAAAGAGATTGATATAGCTGCCAGACTGTTATGGGTTCATGGCGAAGAAGATGAATCTGGAGTGGACTGA
AA sequence Show only first row Show all	>Lus10021834 pacid=23159343 polypeptide=Lus10021834 locus=Lus10021834.g ID=Lus10021834.BGIv1.0 annot-version=v1.0 MQTLQSVLITSLEKSPQTNPIIGRVDKKSGHGFGRPTQKEIDIAARLLWVHGEEDESGVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76140			Prolyl oligopeptidase family p...		Lus10021834 [exp]	0	1
					Lus10039787 [exp]	4.2	0.6396
					Lus10001472 [exp]	5.8	0.7316
					Lus10040143 [exp]	6.2	0.7427
AT2G26850			F-box family protein (.1)		Lus10036444 [exp]	9.6	0.6653
					Lus10022366 [exp]	12.2	0.6542
					Lus10012495 [exp]	16.2	0.6164
					Lus10000882 [exp]	22.2	0.6053
AT4G16640			Matrixin family protein (.1)		Lus10037419 [exp]	23.2	0.6026
AT5G42905			Polynucleotidyl transferase, r...		Lus10007550 [exp]	24.0	0.5899
AT5G63180			Pectin lyase-like superfamily ...		Lus10022310 [exp]	25.1	0.5963

Compare expression of checked genes

Lus10021834 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.