Lus10021835 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76140 155 / 8e-45 Prolyl oligopeptidase family protein (.1.2)
AT1G20380 151 / 2e-43 Prolyl oligopeptidase family protein (.1)
AT1G50380 79 / 8e-18 Prolyl oligopeptidase family protein (.1)
AT1G69020 47 / 7e-07 Prolyl oligopeptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034556 196 / 1e-59 AT1G76140 1056 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Lus10021235 174 / 7e-52 AT1G76140 1184 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Lus10019994 174 / 8e-52 AT1G76140 1008 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Lus10034558 170 / 5e-51 AT1G76140 565 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Lus10015387 76 / 1e-16 AT1G50380 1096 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10032920 72 / 2e-15 AT1G50380 1018 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10004631 50 / 8e-08 AT1G69020 830 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10026683 46 / 3e-06 AT1G69020 785 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10015586 42 / 5e-05 AT1G50380 348 / 5e-114 Prolyl oligopeptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G014000 157 / 1e-45 AT1G76140 1217 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.005G247300 155 / 8e-45 AT1G76140 1206 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.002G013900 154 / 2e-44 AT1G76140 1165 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.005G247400 154 / 3e-44 AT1G76140 1210 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.007G001300 79 / 9e-18 AT1G50380 1149 / 0.0 Prolyl oligopeptidase family protein (.1)
Potri.007G035900 44 / 1e-05 AT5G66960 1087 / 0.0 Prolyl oligopeptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF00326 Peptidase_S9 Prolyl oligopeptidase family
Representative CDS sequence
>Lus10021835 pacid=23159316 polypeptide=Lus10021835 locus=Lus10021835.g ID=Lus10021835.BGIv1.0 annot-version=v1.0
ATGAGTGTACCTGGATTCGATCGAGCAGAGTTCCAAGTGAATCAGGTTTTTGTGACTAGTAAGGAAGGGACCAAGTTCCCGATGTTCATCGGGTCAAAGA
AAGACATGAAACTGGATGGATCACACCCATGCTTGCTGTATGGATATGGTGGATTTGGGTACACCAATACTCCAAATTTCACTGCAAATCGGATAACACT
GGGGAAGCATTTAGGAGTAGTGTTCTGCATTGCCAACATACGTGGTGGTGGAGAGTACGGTGAAGAATGGCACAAAGCAGGATCACTTGCAACAAGCAGA
ACGTCTTTGACGACTTCATCTCTGCCGCTGAATACATCGTATCAGCTGGTTACACCACCCAGAAAAGGCTATGCATCGAAGGTCAAAGCAACGGAGGCCT
CCTCGTAG
AA sequence
>Lus10021835 pacid=23159316 polypeptide=Lus10021835 locus=Lus10021835.g ID=Lus10021835.BGIv1.0 annot-version=v1.0
MSVPGFDRAEFQVNQVFVTSKEGTKFPMFIGSKKDMKLDGSHPCLLYGYGGFGYTNTPNFTANRITLGKHLGVVFCIANIRGGGEYGEEWHKAGSLATSR
TSLTTSSLPLNTSYQLVTPPRKGYASKVKATEASS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G76140 Prolyl oligopeptidase family p... Lus10021835 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10035637 2.4 0.8708
AT1G15940 Tudor/PWWP/MBT superfamily pro... Lus10009948 3.2 0.7859
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10043454 6.0 0.7313
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10019652 6.9 0.7635
AT5G41010 NRPE12, NRPD12,... DNA directed RNA polymerase, 7... Lus10007891 7.3 0.7780
Lus10022997 9.5 0.7659
AT2G21240 BBR_BPC BPC4, BBR/BPC4,... basic pentacysteine 4 (.1.2) Lus10035462 11.2 0.6988
AT5G17680 disease resistance protein (TI... Lus10005174 11.5 0.7702
Lus10041373 14.0 0.7598
AT5G14610 DEAD box RNA helicase family p... Lus10035149 15.2 0.7323

Lus10021835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.