Lus10021842 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42200 104 / 1e-29 RING/U-box superfamily protein (.1)
AT4G40070 74 / 2e-16 RING/U-box superfamily protein (.1)
AT2G42350 69 / 3e-15 RING/U-box superfamily protein (.1)
AT1G53820 69 / 7e-15 RING/U-box superfamily protein (.1)
AT4G09120 69 / 9e-15 RING/U-box superfamily protein (.1)
AT5G47610 65 / 5e-14 RING/U-box superfamily protein (.1)
AT1G72310 66 / 9e-14 ATL3 RING/U-box superfamily protein (.1)
AT5G05280 64 / 1e-13 RING/U-box superfamily protein (.1)
AT2G20030 66 / 2e-13 RING/U-box superfamily protein (.1)
AT3G05200 66 / 2e-13 ATL6 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034551 233 / 1e-80 AT5G42200 112 / 2e-32 RING/U-box superfamily protein (.1)
Lus10005617 157 / 1e-50 AT5G42200 108 / 6e-31 RING/U-box superfamily protein (.1)
Lus10017253 157 / 2e-50 AT5G42200 126 / 4e-38 RING/U-box superfamily protein (.1)
Lus10022743 71 / 6e-16 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10041134 71 / 2e-15 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1)
Lus10036466 71 / 2e-15 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1)
Lus10029178 69 / 1e-14 AT5G40250 297 / 1e-98 RING/U-box superfamily protein (.1)
Lus10012987 68 / 2e-14 AT5G40250 302 / 7e-101 RING/U-box superfamily protein (.1)
Lus10004460 68 / 2e-14 AT3G05200 307 / 6e-102 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G244500 138 / 9e-43 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1)
Potri.002G017400 136 / 6e-42 AT5G42200 154 / 2e-48 RING/U-box superfamily protein (.1)
Potri.010G010500 74 / 6e-17 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.013G025800 71 / 3e-15 AT3G05200 261 / 9e-84 RING/U-box superfamily protein (.1)
Potri.017G072300 70 / 5e-15 AT5G40250 372 / 7e-128 RING/U-box superfamily protein (.1)
Potri.005G036800 69 / 8e-15 AT3G05200 261 / 7e-84 RING/U-box superfamily protein (.1)
Potri.019G130100 67 / 2e-14 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.001G351466 67 / 3e-14 AT5G40250 355 / 2e-121 RING/U-box superfamily protein (.1)
Potri.005G255200 66 / 4e-14 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1)
Potri.002G101800 67 / 5e-14 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10021842 pacid=23159307 polypeptide=Lus10021842 locus=Lus10021842.g ID=Lus10021842.BGIv1.0 annot-version=v1.0
ATGAGTGCTCTGTTCGTTGTCTACATTTGCCTCCTCTGCTTCTCTACCAATCCACCAATCAATCCTATTGTCGTCGGAAGAGAAGACTTGAAGCCGGCAG
TGAAGAAGGGGCTTTCATCGGCGGAGCTTGAGAAGATGCCTAAAGTAACGGGGAAGGAGCTGTGGATGGGGAACGAGTGCGCGGTTTGCCTGGACGAGAT
CGAGGAGAAACAAACGGCGAGACGGATTCCGGTGTGTAACCACGGATTCCACGTGGAATGCGCCGATAAGTGGTTGTCGAATAACCCGTTTTGCCCGGTG
TGCCGGGGCAAAATCGACCGAGATCGGCTGCAGAATCCCGGTGGTTACGAAGACAGTCCTTGCTGA
AA sequence
>Lus10021842 pacid=23159307 polypeptide=Lus10021842 locus=Lus10021842.g ID=Lus10021842.BGIv1.0 annot-version=v1.0
MSALFVVYICLLCFSTNPPINPIVVGREDLKPAVKKGLSSAELEKMPKVTGKELWMGNECAVCLDEIEEKQTARRIPVCNHGFHVECADKWLSNNPFCPV
CRGKIDRDRLQNPGGYEDSPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42200 RING/U-box superfamily protein... Lus10021842 0 1
AT1G31770 ABCG14 ATP-binding cassette G14, ATP-... Lus10033315 7.7 0.5443
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10022436 15.8 0.5994
AT2G37590 DOF AtDof2. 4, ATDO... DNA binding with one finger 2.... Lus10040836 25.9 0.5617
AT3G11110 RING/U-box superfamily protein... Lus10009832 33.1 0.5330
AT5G62940 DOF AtDof5.6, HCA2 HIGH CAMBIAL ACTIVITY2, DNA BI... Lus10042114 40.8 0.5113
AT2G31960 ATGSL3, ATGSL03 glucan synthase-like 3 (.1.2) Lus10003917 75.1 0.4882
AT2G38890 unknown protein Lus10023488 91.5 0.4737
AT1G25275 unknown protein Lus10004192 96.0 0.4648
AT5G61710 unknown protein Lus10025039 129.5 0.4551
AT2G03210 ATFUT2, FUT2 fucosyltransferase 2 (.1) Lus10024079 193.8 0.4020

Lus10021842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.