Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02080 216 / 5e-74 Ribosomal protein S19e family protein (.1) AT5G61170 213 / 1e-72 Ribosomal protein S19e family protein (.1) AT5G15520 211 / 8e-72 Ribosomal protein S19e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030702 [exp] 238 / 8e-83 AT3G02080 215 / 2e-73 Ribosomal protein S19e family protein (.1) Lus10010339 [exp] 237 / 4e-82 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10000095 [exp] 237 / 4e-82 AT3G02080 219 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10013188 [exp] 235 / 2e-81 AT3G02080 259 / 2e-90 Ribosomal protein S19e family protein (.1) Lus10032992 [exp] 233 / 5e-81 AT3G02080 218 / 1e-74 Ribosomal protein S19e family protein (.1) Lus10033532 [exp] 227 / 4e-78 AT3G02080 258 / 3e-90 Ribosomal protein S19e family protein (.1) Lus10020836 [exp] 226 / 1e-77 AT3G02080 258 / 5e-90 Ribosomal protein S19e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G056100 [exp] 214 / 5e-73 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1) Potri.004G118800 [exp] 213 / 1e-72 AT5G61170 269 / 2e-94 Ribosomal protein S19e family protein (.1) Potri.017G092200 [exp] 211 / 7e-72 AT5G61170 270 / 5e-95 Ribosomal protein S19e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF01090 [flax] [poplar] Ribosomal_S19e Ribosomal protein S19e
Representative CDS sequence Show only first row Show all	>Lus10021865 pacid=23157976 polypeptide=Lus10021865 locus=Lus10021865.g ID=Lus10021865.BGIv1.0 annot-version=v1.0 ATGGCTGCTACCGGCGACATCATTGAGCTCCCCCCTTGGACTGATATCGTCAAGACTGGGAAGTTGAAGGAGCTTGCACCTTACGACCCTGACTGGTATT ACATCAGAGCTGCCTCAATGGCGAGAAAGGTATACCTGAGAGGCGGCCTTGGTGTTGGTGCATTCCGTAGAATTTATGGCGGGAGTAAAAGAAATGGAAG CCGACCGCCCCATTTCTGCAAAAGCAGCGGTGCTGTTGCCCGTCACATTCTTCAACAATTGGAGAAGGTTAACATTGTTGAAGTTGATACCAACGGTGGA AGGAAGATTACTTCAAATGGCCAAAGGGATTTGGACCAAGTTGTTGGACGGGTTATTGTTGTTGCTCCTTGA
AA sequence Show only first row Show all	>Lus10021865 pacid=23157976 polypeptide=Lus10021865 locus=Lus10021865.g ID=Lus10021865.BGIv1.0 annot-version=v1.0 MAATGDIIELPPWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGAVARHILQQLEKVNIVEVDTNGG RKITSNGQRDLDQVVGRVIVVAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02080			Ribosomal protein S19e family ...		Lus10021865 [exp]	0	1
AT3G02080			Ribosomal protein S19e family ...		Lus10010339 [exp]	1.0	0.9525
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10000165 [exp]	2.0	0.9433
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10035128 [exp]	2.6	0.9090
AT3G50420			Pentatricopeptide repeat (PPR)...		Lus10022469 [exp]	6.5	0.8761
AT5G57280		RID2	root initiation defective 2, S...		Lus10007484 [exp]	8.1	0.9120
AT2G47640			Small nuclear ribonucleoprotei...		Lus10026556 [exp]	11.0	0.9014
AT5G27700			Ribosomal protein S21e (.1)		Lus10029895 [exp]	11.2	0.9182
AT3G02080			Ribosomal protein S19e family ...		Lus10000095 [exp]	12.0	0.8735
AT4G12060			Double Clp-N motif protein (.1...		Lus10007005 [exp]	13.5	0.8653
AT5G27850			Ribosomal protein L18e/L15 sup...		Lus10041264 [exp]	14.4	0.9132

Compare expression of checked genes

Lus10021865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.