Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04420 44 / 1e-06 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010340 [exp] 134 / 2e-39 AT1G04420 606 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G167400 [exp] 59 / 9e-12 AT1G04420 612 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021867 pacid=23158073 polypeptide=Lus10021867 locus=Lus10021867.g ID=Lus10021867.BGIv1.0 annot-version=v1.0 ATGTCGTCGTCCGGCATTTCCTGCTGTACCACCACGTTGCCGGTGACGAAATATGGCGCATTCTCAACTCGCTGGACATCTCCTCATCGCCTGGCTGGCC ATTCCGGGCTCTCTAGGTCGAGATTCCGACCGATTATTACTGCCGCTCTTGCTCAAAAGACCGCGTTACAGTACAGAAAACTAGGCGACTCCGATCTCGA AATCAGCGAGATCACTATCGGAACAGTTGAGTAA
AA sequence Show only first row Show all	>Lus10021867 pacid=23158073 polypeptide=Lus10021867 locus=Lus10021867.g ID=Lus10021867.BGIv1.0 annot-version=v1.0 MSSSGISCCTTTLPVTKYGAFSTRWTSPHRLAGHSGLSRSRFRPIITAALAQKTALQYRKLGDSDLEISEITIGTVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021867 [exp]	0	1
AT1G04945			HIT-type Zinc finger family pr...		Lus10008703 [exp]	7.7	0.7305
AT1G57540			unknown protein		Lus10024000 [exp]	15.0	0.7261
AT3G62330			Zinc knuckle (CCHC-type) famil...		Lus10025019 [exp]	23.7	0.7027
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10000415 [exp]	27.7	0.6161
AT5G13920			GRF zinc finger / Zinc knuckle...		Lus10020975 [exp]	30.0	0.6103
AT3G10572		APEM9	ABERRANT PEROXISOME MORPHOLOGY...		Lus10021597 [exp]	30.5	0.7183
AT5G47650		ATNUDX2, ATNUDT...	ARABIDOPSIS THALIANA NUDIX HYD...		Lus10012319 [exp]	34.2	0.7122
AT1G04420			NAD(P)-linked oxidoreductase s...		Lus10021866 [exp]	45.8	0.6825
					Lus10027784 [exp]	61.2	0.6735
					Lus10008388 [exp]	95.9	0.6732

Compare expression of checked genes

Lus10021867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.