Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43390 39 / 7e-05 Uncharacterised conserved protein UCP015417, vWA (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041147 [exp] 59 / 6e-12 AT5G43400 823 / 0.0 Uncharacterised conserved protein UCP015417, vWA (.1) Lus10021875 [exp] 51 / 3e-09 AT5G43390 803 / 0.0 Uncharacterised conserved protein UCP015417, vWA (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021874 pacid=23158040 polypeptide=Lus10021874 locus=Lus10021874.g ID=Lus10021874.BGIv1.0 annot-version=v1.0 ATGAGACCAAGCCAATTGGAGTCGCTCGATCACTTGATCGGCGGGCGTGTCTGGGACGATATGGAAGAAGAAATCGAGACAGGATTACCGATGGAGAGCT ACTGGGTGTGTTTTCGTACCAGTTCTGCGATGTTATTCTCAACAGTGAAATGGTCGTGTTTGTCTGCAGATTTGACCTACACGATTAAGTAG
AA sequence Show only first row Show all	>Lus10021874 pacid=23158040 polypeptide=Lus10021874 locus=Lus10021874.g ID=Lus10021874.BGIv1.0 annot-version=v1.0 MRPSQLESLDHLIGGRVWDDMEEEIETGLPMESYWVCFRTSSAMLFSTVKWSCLSADLTYTIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021874 [exp]	0	1
AT1G67623			F-box family protein (.1)		Lus10030128 [exp]	1.7	0.9176
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10031808 [exp]	7.6	0.8618
AT2G04040		ATDTX1	detoxification 1, MATE efflux ...		Lus10009132 [exp]	9.3	0.8439
AT1G09600			Protein kinase superfamily pro...		Lus10000170 [exp]	9.4	0.8196
AT1G09290			unknown protein		Lus10012754 [exp]	14.0	0.7919
AT3G54310			unknown protein		Lus10004782 [exp]	15.7	0.7782
					Lus10003272 [exp]	17.1	0.7718
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Lus10003626 [exp]	18.3	0.7718
					Lus10010826 [exp]	19.4	0.7718
					Lus10011629 [exp]	20.5	0.7718

Compare expression of checked genes

Lus10021874 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.