Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041175 [exp] 0 / 1 ND / Lus10025349 [exp] 0 / 1 AT5G02370 536 / 0.0 ATP binding microtubule motor family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021893 pacid=23158032 polypeptide=Lus10021893 locus=Lus10021893.g ID=Lus10021893.BGIv1.0 annot-version=v1.0 ATGGTCAATCATATCGATGTCCGAGATAGAGTTGATGATCTGCCTCAAAACACCTATTGTGATGTGTGCTATAATCGACCAAGAGTATCAAGAGTCAGTA CATACCGTCAGCTTGGCATCTGCAACGTGACAAAGGTCAAATTGGGCATGCAAGGGCTTGAATCAAGAGGCAAGACGAGGAGTGTCCCAAAACCGAGGGT CTGTGCTTCTTCATTTCCTGTTAGCAAGAAGCTTGATTTCCTAGGCTCAGTCAAGGACAGGGTCAATTCTCACCGCAGAGCTTCAAACTCCAAGAACAGG TATAGCCAGGGGTCAGGTCAGAGCTCCATCCCTGATGTTTGTTCGTTCATATGA
AA sequence Show only first row Show all	>Lus10021893 pacid=23158032 polypeptide=Lus10021893 locus=Lus10021893.g ID=Lus10021893.BGIv1.0 annot-version=v1.0 MVNHIDVRDRVDDLPQNTYCDVCYNRPRVSRVSTYRQLGICNVTKVKLGMQGLESRGKTRSVPKPRVCASSFPVSKKLDFLGSVKDRVNSHRRASNSKNR YSQGSGQSSIPDVCSFI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021893 [exp]	0	1
AT2G34930			disease resistance family prot...		Lus10039529 [exp]	1.0	0.7561
AT1G65550			Xanthine/uracil permease famil...		Lus10014777 [exp]	4.5	0.7106
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10013268 [exp]	6.3	0.7404
AT5G55180			O-Glycosyl hydrolases family 1...		Lus10004391 [exp]	7.7	0.6887
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	7.7	0.7404
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	8.9	0.7404
AT3G05950			RmlC-like cupins superfamily p...		Lus10035280 [exp]	10.0	0.7404
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10005476 [exp]	11.0	0.7263
					Lus10014650 [exp]	12.1	0.7228
					Lus10027457 [exp]	13.3	0.7223

Compare expression of checked genes

Lus10021893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.