Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041176 [exp] 112 / 1e-33 AT5G02370 57 / 3e-10 ATP binding microtubule motor family protein (.1) Lus10024395 [exp] 109 / 1e-29 AT5G02370 593 / 0.0 ATP binding microtubule motor family protein (.1) Lus10025349 [exp] 108 / 3e-29 AT5G02370 536 / 0.0 ATP binding microtubule motor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G085300 [exp] 41 / 2e-05 AT5G02370 660 / 0.0 ATP binding microtubule motor family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021894 pacid=23158087 polypeptide=Lus10021894 locus=Lus10021894.g ID=Lus10021894.BGIv1.0 annot-version=v1.0 ATGGGCGGGAACACCTTGACAGTTGCACCGCAAGCTGCTGAGAAGAAAACCAGTAGCATGGACCAAAGCCCTTTGAGGAAGGTGTTATCCCCGATATGTT CAAACATTAACAGGGTGGCTCAGCAGGAAGCTACTCCTCCAAAAACACCACTCCATGCTCTCCAAGGAGAGAACAACTACAACAATACGGTGATTACCCC ACTTGAGAAGTTCAACACCACGAGCTCTAGGCTAAAGATCAAATAA
AA sequence Show only first row Show all	>Lus10021894 pacid=23158087 polypeptide=Lus10021894 locus=Lus10021894.g ID=Lus10021894.BGIv1.0 annot-version=v1.0 MGGNTLTVAPQAAEKKTSSMDQSPLRKVLSPICSNINRVAQQEATPPKTPLHALQGENNYNNTVITPLEKFNTTSSRLKIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021894 [exp]	0	1
AT1G75800			Pathogenesis-related thaumatin...		Lus10023897 [exp]	1.0	0.9701
AT5G62470	MYB	ATMYB96, mybcov...	myb domain protein 96 (.1.2)		Lus10002056 [exp]	2.0	0.9549
AT3G54200			Late embryogenesis abundant (L...		Lus10003238 [exp]	4.0	0.9290
AT1G01120		KCS1	3-ketoacyl-CoA synthase 1 (.1)		Lus10002691 [exp]	5.5	0.9156
AT2G04570			GDSL-like Lipase/Acylhydrolase...		Lus10031520 [exp]	6.5	0.9301
AT3G57030			Calcium-dependent phosphotries...		Lus10019148 [exp]	8.9	0.9032
					Lus10007554 [exp]	9.9	0.9028
					Lus10011452 [exp]	10.0	0.9006
					Lus10017869 [exp]	10.7	0.9189
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009003 [exp]	11.2	0.9051

Compare expression of checked genes

Lus10021894 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.