Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 359 / 2e-128 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 355 / 7e-127 PBD2 20S proteasome beta subunit D2 (.1.2) AT1G53850 64 / 2e-12 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 64 / 3e-12 PAE2 20S proteasome alpha subunit E2 (.1) AT1G13060 51 / 1e-07 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 50 / 1e-07 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G60820 50 / 2e-07 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 45 / 8e-06 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 45 / 9e-06 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G56450 43 / 5e-05 PBG1 20S proteasome beta subunit G1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041194 [exp] 415 / 2e-150 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10039351 [exp] 387 / 3e-139 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10006596 [exp] 179 / 1e-58 AT3G22630 168 / 2e-54 20S proteasome beta subunit D1 (.1) Lus10003936 [exp] 61 / 6e-11 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 61 / 8e-11 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10006426 [exp] 50 / 3e-07 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 49 / 6e-07 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10015867 [exp] 47 / 2e-06 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10032102 [exp] 47 / 4e-06 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G084800 [exp] 366 / 8e-131 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.008G155500 [exp] 365 / 1e-130 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.001G162900 [exp] 61 / 2e-11 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 58 / 3e-10 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.014G069800 [exp] 52 / 2e-08 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G177000 [exp] 53 / 3e-08 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.002G148300 [exp] 52 / 5e-08 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.010G058100 [exp] 49 / 5e-07 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.004G066000 [exp] 46 / 5e-06 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 45 / 1e-05 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10021909 pacid=23158006 polypeptide=Lus10021909 locus=Lus10021909.g ID=Lus10021909.BGIv1.0 annot-version=v1.0 ATGGAGTGCGTATTTGGGTTAGTAGGAAACGATTTCGCAATAGTTGCGGCAGATACGTCGGCCGTCCATAGCATCCTGGTCCACAAATCCAACGAGGACA AGATCATGCTCCTCGACTCCCACAAGCTCGTCGCCGCCAGCGGCGAGCCCGGCGATAGGGTTCAATTCACGGAGTACATCCAGAAGAACGTGACTTTGTA TCAGTTCAGGAATGGAATTCCTCTTACCACGCCTGCTGCAGCCAACTTTACTCGAGGGGAGCTGGCTACTGCTTTGAGAAAGAATCCTTATCAAGTTAAC CTCTTGATGGCTGGCTATGACAAAGACATAGGCCCATCTTTGTATTACATCGACTACATTGCTACCCTTCACAAGGTTGACAAGGGTGCATTCGGCTATG GCTCCTATTTCTGTCTTTCCATGATGGATCGACTCTACCACAGCGGCATGGCTGTGGAGGAAGCTATTGATCTCATAGACAAGTGCATAGCGGAGATCCG GTTGAGGTTGGTAGTGGCACCACCAAATTTCGTCATTAAAATCGTCGACAAGGACGGGGCAAGGGAGTACGCCTGGCGTAAGTCTGTCGATGATGATGAA GCAGCAGCTTAA
AA sequence Show only first row Show all	>Lus10021909 pacid=23158006 polypeptide=Lus10021909 locus=Lus10021909.g ID=Lus10021909.BGIv1.0 annot-version=v1.0 MECVFGLVGNDFAIVAADTSAVHSILVHKSNEDKIMLLDSHKLVAASGEPGDRVQFTEYIQKNVTLYQFRNGIPLTTPAAANFTRGELATALRKNPYQVN LLMAGYDKDIGPSLYYIDYIATLHKVDKGAFGYGSYFCLSMMDRLYHSGMAVEEAIDLIDKCIAEIRLRLVVAPPNFVIKIVDKDGAREYAWRKSVDDDE AAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10021909 [exp]	0	1
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10013287 [exp]	2.6	0.9435
AT5G46840			RNA-binding (RRM/RBD/RNP motif...		Lus10004563 [exp]	2.8	0.9230
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10030810 [exp]	4.7	0.9414
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10022726 [exp]	6.0	0.9268
AT2G03340	WRKY	WRKY3	WRKY DNA-binding protein 3 (.1...		Lus10033000 [exp]	7.4	0.9162
AT4G08580			microfibrillar-associated prot...		Lus10020319 [exp]	8.9	0.9009
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Lus10036164 [exp]	9.2	0.9070
AT5G22080			Chaperone DnaJ-domain superfam...		Lus10013354 [exp]	9.2	0.9151
AT5G18610			Protein kinase superfamily pro...		Lus10033966 [exp]	9.7	0.9010
AT4G07400		VFB3	VIER F-box proteine 3 (.1)		Lus10024799 [exp]	10.4	0.8686

Compare expression of checked genes

Lus10021909 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.