Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 115 / 4e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 109 / 8e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 87 / 8e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 77 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 72 / 1e-16 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G64080 68 / 2e-14 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 67 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 62 / 4e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22580 56 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041197 [exp] 230 / 4e-78 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 167 / 3e-53 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 162 / 2e-51 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 113 / 9e-32 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 101 / 2e-27 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 90 / 2e-22 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 87 / 8e-22 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039349 [exp] 86 / 3e-21 AT3G22600 119 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 86 / 3e-21 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085400 [exp] 144 / 4e-44 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 142 / 2e-43 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 109 / 1e-30 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 105 / 4e-29 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 104 / 3e-28 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 100 / 5e-27 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 87 / 1e-21 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 85 / 7e-21 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 74 / 8e-17 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G158100 [exp] 72 / 9e-16 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10021912 pacid=23158049 polypeptide=Lus10021912 locus=Lus10021912.g ID=Lus10021912.BGIv1.0 annot-version=v1.0 ATGGCGGGAAGAAGCATTGCATTGAGTTTGGGCATTCTGTTGCTTACCATGCAGTTGTGGATGATGGTCATGGCTCAGTCTGATTGTTCCACCGTGCTAC TTACCTTATCTCCCTGCCTGGATTACATGTCCAGTAAATCGCCGACTCCCTCGCAGCAATGCTGCAGCCAGTTCGAGTCGGTGGTTCGTTCTGCTCCAAT GTGCCTGTGTCAGGTTCTTGAAGGCGGCGGTTCTTCATTTGGCGTCGAGCTCAACCAAACTCGTGCCTTGGAATTACCTGCTGCTTGTAAAATCGAGGCC CCGCCTGCTAGCCACTGCAATGCTACTTCTCCAACTACAGCTCCCCTCGGGAGCGAAGAACCAGCCACTCCAAGTACTTCAGGTGAATCTGGAAGCGAGT CAGGAAGTGGTACGTCCAATGGGAGCTCCATGAAGGTTTCAATGTCTTCGCTCTTCTTCTTTCTCTTAGCAGCCTCGTTTTTTTTCCATGAGATACTAAA ATCCGAGCTACCCGCCACTCTTATATAA
AA sequence Show only first row Show all	>Lus10021912 pacid=23158049 polypeptide=Lus10021912 locus=Lus10021912.g ID=Lus10021912.BGIv1.0 annot-version=v1.0 MAGRSIALSLGILLLTMQLWMMVMAQSDCSTVLLTLSPCLDYMSSKSPTPSQQCCSQFESVVRSAPMCLCQVLEGGGSSFGVELNQTRALELPAACKIEA PPASHCNATSPTTAPLGSEEPATPSTSGESGSESGSGTSNGSSMKVSMSSLFFFLLAASFFFHEILKSELPATLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10021912 [exp]	0	1
AT5G40380		CRK42	cysteine-rich RLK (RECEPTOR-li...		Lus10036028 [exp]	7.5	0.6216
AT3G11430		ATGPAT5, GPAT5	glycerol-3-phosphate acyltrans...		Lus10018832 [exp]	15.8	0.6310
AT5G20270		HHP1	heptahelical transmembrane pro...		Lus10038120 [exp]	29.4	0.6127
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10042339 [exp]	34.6	0.5954
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10017751 [exp]	57.4	0.5650
AT2G23470		RUS4	ROOT UV-B SENSITIVE 4, Protein...		Lus10016778 [exp]	61.2	0.5656
AT4G39955			alpha/beta-Hydrolases superfam...		Lus10023147 [exp]	70.4	0.5554
AT2G45750			S-adenosyl-L-methionine-depend...		Lus10036562 [exp]	84.2	0.5126
AT4G16060			unknown protein		Lus10016832 [exp]	93.5	0.5425
AT2G23470		RUS4	ROOT UV-B SENSITIVE 4, Protein...		Lus10022474 [exp]	94.7	0.5254

Compare expression of checked genes

Lus10021912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.