Lus10021921 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021921 pacid=23158051 polypeptide=Lus10021921 locus=Lus10021921.g ID=Lus10021921.BGIv1.0 annot-version=v1.0
ATGGCTGGTAGATTTAGAAGAACGATTCTGGGTTACAGGAGCATGATCATCTTGGTCCTAGCATTTGCATTTCTGTCCGGGTCGTCTAATTTGACTGCGG
GACATGCTGTTAGTTTTCCAGAATCCAGGGAAGAAGCAAAGATCAGTTGTGGAGAAAAGGAGACCCAGAAGTTGCATCATGTTTCCAAAGGTGGTGTACG
CGGGAGTAGTTCAGGGCAAGGTGGGCATGGACATCACTGA
AA sequence
>Lus10021921 pacid=23158051 polypeptide=Lus10021921 locus=Lus10021921.g ID=Lus10021921.BGIv1.0 annot-version=v1.0
MAGRFRRTILGYRSMIILVLAFAFLSGSSNLTAGHAVSFPESREEAKISCGEKETQKLHHVSKGGVRGSSSGQGGHGHH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021921 0 1
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10012002 9.0 0.8050
AT5G59070 UDP-Glycosyltransferase superf... Lus10016475 17.1 0.8137
AT3G07870 F-box and associated interacti... Lus10012358 18.0 0.7754
AT1G14185 Glucose-methanol-choline (GMC)... Lus10012818 18.2 0.7575
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029812 25.7 0.6900
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Lus10012147 46.2 0.7405
AT2G41660 MIZ1 mizu-kussei 1, Protein of unkn... Lus10035443 48.8 0.7203
AT2G45750 S-adenosyl-L-methionine-depend... Lus10005764 52.4 0.7800
AT4G34880 Amidase family protein (.1) Lus10027852 79.0 0.7546
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10008259 95.0 0.7188

Lus10021921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.