Lus10021932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06050 310 / 6e-108 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
AT1G60740 115 / 4e-32 Thioredoxin superfamily protein (.1)
AT1G65970 112 / 5e-31 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G65980 112 / 1e-30 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT3G52960 110 / 2e-29 Thioredoxin superfamily protein (.1)
AT1G65990 79 / 2e-16 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041218 286 / 7e-96 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Lus10023180 110 / 7e-30 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023662 108 / 2e-29 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10015077 108 / 3e-29 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10002843 108 / 2e-28 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10003373 107 / 5e-28 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G024000 317 / 8e-111 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
Potri.013G102100 112 / 5e-30 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.001G423500 108 / 2e-29 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.018G083500 107 / 5e-29 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Lus10021932 pacid=23158023 polypeptide=Lus10021932 locus=Lus10021932.g ID=Lus10021932.BGIv1.0 annot-version=v1.0
ATGGGCCAGGCCCAATTAATCTCAATCAACCTAGTCCAGCCGTCTCTGGTCTCACTTCCTCATCATCCACCGCACTCTCAACATCGGCGAAGGCTGAAGA
AAACTTCGAGCATCTACACAACCACAGTCCACAAGTATCGGAATCTTAATCAAGCAACAGAGATGGCATCTGCAGTAGTTAGAAGAGCCAAGGCGTCGGC
ATTCAAGTCGGTGGTCGGCAGTCTACGAGTGGCTGGATCGTCGAGATCCTACGCCAAGGTTGCCGTTGGGGCTGATCTAGTATCGGCCGCCCCCGATGTC
GCCCTCCAGAAAGCTCGCACCTGGGACGAAGGCGTCTCTTCCAAATTCTCCACTACCCCTCTCAAAGACATTTTCAAGGGCAAGAAAGTTGTCATCTTTG
GTCTTCCAGGTGCATACACAGGTGTTTGCTCGCAGCAGCATGTCCCTAGTTACAAGAACAACGCAGATAAGTTCAAGGCTAAAGGAATTGATTCGATCAT
TTGCGTGTCGGTTAACGACCCTTATGTGATGAATGGTTGGGCAGAGAAACTTCAAGCTAAAGATGATCTCGAATTCTACGGAGACTTTGATGGGAAGTTC
CACAAGAGCTTGGAGCTAACTAAGGATCTCTCTGGTGCTTTGCTTGGACCTCGCTCTGAAAGATGGTCTGCTTATGTTGATGATGGGAAAGTTAAGGTCC
TTAATGTCGAGGAAGTCCCGTCGGATTTCAAGGTTTCTGGCGGTGAGGTTATTTTGGGACTGATATGA
AA sequence
>Lus10021932 pacid=23158023 polypeptide=Lus10021932 locus=Lus10021932.g ID=Lus10021932.BGIv1.0 annot-version=v1.0
MGQAQLISINLVQPSLVSLPHHPPHSQHRRRLKKTSSIYTTTVHKYRNLNQATEMASAVVRRAKASAFKSVVGSLRVAGSSRSYAKVAVGADLVSAAPDV
ALQKARTWDEGVSSKFSTTPLKDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKNNADKFKAKGIDSIICVSVNDPYVMNGWAEKLQAKDDLEFYGDFDGKF
HKSLELTKDLSGALLGPRSERWSAYVDDGKVKVLNVEEVPSDFKVSGGEVILGLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06050 PRXIIF, ATPRXII... peroxiredoxin IIF (.1) Lus10021932 0 1
AT1G30580 GTP binding (.1) Lus10023261 1.0 0.8254
AT2G05840 PAA2 20S proteasome subunit PAA2 (.... Lus10027669 4.0 0.7858
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10041296 9.2 0.7383
AT2G35605 SWIB/MDM2 domain superfamily p... Lus10033312 9.4 0.7216
AT5G17690 AtLHP1, LHP1, T... TERMINAL FLOWER 2, LIKE HETERO... Lus10005669 9.8 0.7201
AT4G12590 Protein of unknown function DU... Lus10039028 13.0 0.7643
AT3G27430 PBB1 N-terminal nucleophile aminohy... Lus10032102 13.0 0.7412
AT3G18240 Ribosomal protein S24/S35, mit... Lus10022237 15.9 0.7292
AT3G16780 Ribosomal protein L19e family ... Lus10023388 16.4 0.7399
AT2G04740 ankyrin repeat family protein ... Lus10012362 16.5 0.6779

Lus10021932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.