Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23610 226 / 4e-76 DSPTP1 dual specificity protein phosphatase 1 (.1.2.3) AT3G06110 174 / 6e-56 DSPTP1B, MKP2, ATMKP2 DUAL-SPECIFICITY PROTEIN PHOSPHATASE 1B, ARABIDOPSIS MAPK PHOSPHATASE 2, MAPK phosphatase 2 (.1.2.3) AT5G23720 98 / 5e-24 PHS1 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) AT3G55270 81 / 6e-18 MKP1, ATMKP1 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) AT2G04550 79 / 6e-18 DSPTP1E, IBR5 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) AT5G56610 58 / 1e-10 Phosphotyrosine protein phosphatases superfamily protein (.1.2) AT2G35680 48 / 9e-07 Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041227 [exp] 303 / 1e-106 AT3G23610 237 / 4e-80 dual specificity protein phosphatase 1 (.1.2.3) Lus10034033 [exp] 154 / 1e-48 AT3G23610 168 / 5e-54 dual specificity protein phosphatase 1 (.1.2.3) Lus10032545 [exp] 95 / 6e-23 AT5G23720 1120 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Lus10043195 [exp] 93 / 3e-22 AT5G23720 1047 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Lus10006229 [exp] 88 / 2e-20 AT3G23610 512 / 1e-171 dual specificity protein phosphatase 1 (.1.2.3) Lus10036877 [exp] 87 / 2e-20 AT3G23610 511 / 3e-171 dual specificity protein phosphatase 1 (.1.2.3) Lus10000921 [exp] 82 / 4e-19 AT2G04550 322 / 1e-111 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) Lus10002263 [exp] 82 / 6e-19 AT2G04550 327 / 1e-113 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) Lus10030324 [exp] 77 / 1e-16 AT3G55270 806 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G033000 [exp] 247 / 1e-84 AT3G23610 249 / 4e-85 dual specificity protein phosphatase 1 (.1.2.3) Potri.012G105800 [exp] 101 / 3e-25 AT5G23720 1006 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Potri.015G105000 [exp] 95 / 5e-23 AT5G23720 1096 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Potri.008G049900 [exp] 83 / 8e-19 AT3G55270 710 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Potri.010G210900 [exp] 83 / 1e-18 AT3G55270 715 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Potri.014G160500 [exp] 81 / 2e-18 AT2G04550 333 / 6e-116 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) Potri.016G035700 [exp] 74 / 5e-16 AT4G18593 149 / 3e-44 dual specificity protein phosphatase-related (.1) Potri.006G040300 [exp] 74 / 1e-15 AT4G18593 148 / 5e-44 dual specificity protein phosphatase-related (.1) Potri.014G045500 [exp] 57 / 5e-10 AT2G35680 360 / 2e-124 Phosphotyrosine protein phosphatases superfamily protein (.1) Potri.002G136700 [exp] 53 / 2e-08 AT2G35680 350 / 1e-120 Phosphotyrosine protein phosphatases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00782 [flax] [poplar] DSPc Dual specificity phosphatase, catalytic domain
Representative CDS sequence Show only first row Show all	>Lus10021940 pacid=23158055 polypeptide=Lus10021940 locus=Lus10021940.g ID=Lus10021940.BGIv1.0 annot-version=v1.0 ATGGCTCAGTTTGATGATGTGATGAAGAACCAAATTGCTGCGATTTTGAGGGTTATAAATTACTCAAAGAGCTTTAAAGAGGACAATATTCCATGCCTCA TCGAAGAGGGATTGTTCTTGGGGTCTGTTGGTGCGGCTAACAACAAGAATGCACTGAAAAGCAACAACATCACTCACATATTGACAGTAGCAAATTCAAT AGCTCCGGTCTATCCCAATGATTTTGTATATAAGGTTATTGCAGTTGCGGATAGAGAAGAAACAAATTTGAGACAGTATTTTGAAGAGGGCATCAATTTC ATTGATGAAGCCAAAAGACAAGGTGGTGGTGTTTTGGTGCATTGCTTTGTTGGAAGGTCCAGGAGTGTCACGATAATTCTTGCCTACCTGATGAAGAAGC ATGGCATGACGGTATCTCAAGCTCTAGAACATGTAAGGTCTAGAAGACCTCAAGCATCTCCGAATTTCGGCTTCGTTTCACAGCTCCAAGAGTATGAGAG ATTGCTTAAAGGTGCACCATTCTGTTAG
AA sequence Show only first row Show all	>Lus10021940 pacid=23158055 polypeptide=Lus10021940 locus=Lus10021940.g ID=Lus10021940.BGIv1.0 annot-version=v1.0 MAQFDDVMKNQIAAILRVINYSKSFKEDNIPCLIEEGLFLGSVGAANNKNALKSNNITHILTVANSIAPVYPNDFVYKVIAVADREETNLRQYFEEGINF IDEAKRQGGGVLVHCFVGRSRSVTIILAYLMKKHGMTVSQALEHVRSRRPQASPNFGFVSQLQEYERLLKGAPFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10021940 [exp]	0	1
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	2.0	0.8725
AT3G58090			Disease resistance-responsive ...		Lus10009074 [exp]	3.2	0.8382
AT5G59550			zinc finger (C3HC4-type RING f...		Lus10010856 [exp]	3.5	0.8614
					Lus10023092 [exp]	4.2	0.8304
					Lus10034884 [exp]	4.5	0.8388
AT4G22950	MADS	AGL19	AGAMOUS-like 19 (.1)		Lus10006715 [exp]	5.1	0.8654
AT3G13480			unknown protein		Lus10010318 [exp]	5.5	0.8116
					Lus10039994 [exp]	7.7	0.8012
AT3G22430			unknown protein		Lus10021917 [exp]	11.0	0.7820
AT1G27180			disease resistance protein (TI...		Lus10023093 [exp]	12.0	0.8049

Compare expression of checked genes

Lus10021940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.