Lus10021972 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22700 298 / 2e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT3G11540 61 / 1e-10 SPY SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT3G04240 45 / 3e-05 SEC secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041265 400 / 2e-141 AT1G22700 303 / 5e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10021336 60 / 4e-10 AT3G11540 1509 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10017009 59 / 5e-10 AT3G11540 1356 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10013661 47 / 6e-06 AT5G63200 801 / 0.0 tetratricopeptide repeat (TPR)-containing protein (.1)
Lus10035117 44 / 5e-05 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10031983 43 / 0.0001 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Lus10003576 42 / 0.0002 AT3G04240 1606 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10023748 41 / 0.0004 AT4G28600 753 / 0.0 no pollen germination related 2 (.1)
Lus10003113 41 / 0.0006 AT3G04240 1687 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G114500 347 / 5e-121 AT1G22700 321 / 7e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.019G085200 343 / 7e-120 AT1G22700 324 / 6e-111 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.016G075700 60 / 2e-10 AT3G11540 1505 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.006G208900 59 / 5e-10 AT3G11540 1506 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.005G054800 43 / 0.0001 AT3G04710 611 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Potri.012G092000 43 / 0.0001 AT5G63200 759 / 0.0 tetratricopeptide repeat (TPR)-containing protein (.1)
Potri.006G178900 42 / 0.0002 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.010G068700 42 / 0.0002 AT4G28600 708 / 0.0 no pollen germination related 2 (.1)
Potri.018G100700 40 / 0.0006 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.001G473100 40 / 0.0007 AT5G56290 978 / 0.0 EMBRYO DEFECTIVE 2790, ARABIDOPSIS PEROXIN 5, peroxin 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF00515 TPR_1 Tetratricopeptide repeat
Representative CDS sequence
>Lus10021972 pacid=23158033 polypeptide=Lus10021972 locus=Lus10021972.g ID=Lus10021972.BGIv1.0 annot-version=v1.0
ATGAGAAAGTTAATACTTTGGATATCTGCCCTCTCTGTTCAACAAGTTTCGTTCTTGATACCTGCACAAGCAGCAAATGCGAGTGAAAGTATCAGACCAG
GTGCACTATATGATGTCGGCGAGTTATTTGAACTGGGAATCCAGCTATCGTATCTGCTATTGCTGCTGGCGCTGCTTGGTGTTGGAACGTTCTTCGTGAT
TCGCCAAGTTCTTGTTCGTAGAGAACTCGATCTTTCTGCTAAGGAACTACAGGCAGTAAGGAGTGGTGATGCAAGTGCTACCGAGTTGTTTGAACTTGGA
GCTGTGATGTTGAGGAGGAAGTTCTACCCTGCTGCCACCAAATATTTGCTTCAAGCGATTGAGAAATGGGATGGTGACGATCAGGATCTAGCGCAGGTGT
ACAATGCACTTGGGGTGAGTTATATCCGAGACGGAAAGACAGATAAAGGTGTAGCTATGCTTGAGAAGGCAGTGAAGCTTCAGCCTGGGTATGTAACTGC
ATGGAACAACCTGGGAGATGCTTACGAGAAGAAGAATGACATGAAAGGAGCCCTCAAGGCATTCGAGGAAGCGCTGTTGTTTGATCCCAATAATAAGGTG
GCACGGCCACGTAGAGATGGACTTAGGGATCGTGTGCAGATGTACAAAGGCGTGCCTGTGAAATCAAAGGATCGATAA
AA sequence
>Lus10021972 pacid=23158033 polypeptide=Lus10021972 locus=Lus10021972.g ID=Lus10021972.BGIv1.0 annot-version=v1.0
MRKLILWISALSVQQVSFLIPAQAANASESIRPGALYDVGELFELGIQLSYLLLLLALLGVGTFFVIRQVLVRRELDLSAKELQAVRSGDASATELFELG
AVMLRRKFYPAATKYLLQAIEKWDGDDQDLAQVYNALGVSYIRDGKTDKGVAMLEKAVKLQPGYVTAWNNLGDAYEKKNDMKGALKAFEEALLFDPNNKV
ARPRRDGLRDRVQMYKGVPVKSKDR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22700 Tetratricopeptide repeat (TPR)... Lus10021972 0 1
AT3G52380 CP33, PDE322 PIGMENT DEFECTIVE 322, chlorop... Lus10016174 1.0 0.9649
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10015111 1.7 0.9450
AT3G02450 cell division protein ftsH, pu... Lus10034097 2.2 0.9412
AT5G57030 LUT2 LUTEIN DEFICIENT 2, Lycopene b... Lus10021576 2.8 0.9460
AT1G60230 Radical SAM superfamily protei... Lus10013005 2.8 0.9414
AT4G02790 EMB3129 EMBRYO DEFECTIVE 3129, GTP-bin... Lus10014672 5.5 0.9363
AT3G10230 AtLCY, LYC lycopene cyclase (.1.2) Lus10027278 5.7 0.9292
AT1G04420 NAD(P)-linked oxidoreductase s... Lus10010340 5.8 0.9252
AT1G22700 Tetratricopeptide repeat (TPR)... Lus10041265 6.3 0.9303
AT3G01480 ATCYP38, CYP38 ARABIDOPSIS CYCLOPHILIN 38, cy... Lus10032151 9.2 0.9335

Lus10021972 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.