Lus10021974 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041267 94 / 8e-24 AT2G33460 55 / 5e-09 ROP-interactive CRIB motif-containing protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G147000 62 / 2e-12 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.002G233400 59 / 6e-11 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10021974 pacid=23158069 polypeptide=Lus10021974 locus=Lus10021974.g ID=Lus10021974.BGIv1.0 annot-version=v1.0
ATGACCCAATCATCATCATCGTCATCTTCTGGGAAGGTCGTTGACAGATTCGTATTTCTTCCATTGATCTCTTTCATCGGCGGCGGCGGCGGCTGTAATT
CTCACTCAAGCATCCAGGTCGACCACAATGCTACTGATCATGATGAGCAACGACGACGACCACCACTTCCCACCAAATCACTCAAGTATCCAGGTCGTCC
ACTAACAGTTAATTACAAGCAAAGTGGAGAGGAGGAGGAAGAGTTAGAAGAGGAAAAGGAGATGGAGATTGGATTCCCAACGGATGTAAAGCATGTAACA
CACATTGGCTTGGATGGCACTACTAAGAATAACCCTACTGCTACTGCTACCAAAGGCCTTGATGCTGGGGATGATTGGATGGACAGCCTCAAAAAGGCTA
GTAATACTCCAGCTGATCAGATCATATCTTTTCCAACCATATCTCTCAAGCAGTTCGAGCTCGCCATGTCTGCCCAAGCCCATGGCCACACCTTCAACCA
GCACCTTGCCTAG
AA sequence
>Lus10021974 pacid=23158069 polypeptide=Lus10021974 locus=Lus10021974.g ID=Lus10021974.BGIv1.0 annot-version=v1.0
MTQSSSSSSSGKVVDRFVFLPLISFIGGGGGCNSHSSIQVDHNATDHDEQRRRPPLPTKSLKYPGRPLTVNYKQSGEEEEELEEEKEMEIGFPTDVKHVT
HIGLDGTTKNNPTATATKGLDAGDDWMDSLKKASNTPADQIISFPTISLKQFELAMSAQAHGHTFNQHLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G33460 RIC1 ROP-interactive CRIB motif-con... Lus10021974 0 1
AT1G07630 PLL5 pol-like 5 (.1) Lus10024397 1.4 0.9508
Lus10025897 1.7 0.9394
AT1G08320 bZIP TGA9, bZIP21 TGACG \(TGA\) motif-binding pr... Lus10004876 2.0 0.9442
AT1G07630 PLL5 pol-like 5 (.1) Lus10025348 3.5 0.9185
AT2G15790 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptid... Lus10012059 3.5 0.9355
AT3G11600 unknown protein Lus10043404 4.4 0.8806
AT2G36090 F-box family protein (.1) Lus10017006 4.5 0.9279
AT4G02090 unknown protein Lus10010014 6.0 0.8807
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10004318 7.1 0.8983
AT4G16640 Matrixin family protein (.1) Lus10007478 7.3 0.9046

Lus10021974 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.