Lus10021979 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021979 pacid=23160209 polypeptide=Lus10021979 locus=Lus10021979.g ID=Lus10021979.BGIv1.0 annot-version=v1.0
ATGAAGAACAGCACTACCATGACTACTCATCATCTACTACTCCTTCTGCTAGCTAATTTACCACTCATCATCATCTTCGTCGTATTAGGTGTCGGAGTTC
AGCCTGCAAATTCATGCCGCGTTCTTCTCGATCGACCTCTTCCGGACAACGATCTTCGTCCAAAGAACGAAACTCTTCCAGCTAATATTCAACAAAAACT
ACCTCTGCCAACTAATAATGGGTCAGTAGCAGCAGCAGTAGCAGGAGCGGCACCAGCCAAGTATCGAACACCGCCTCCGCCACCAGCTGAAGGTGAGCCG
TCGATTAGCATCTGCCGGAGCTGGTCTCCGCCGGGAAGCCACGGATAA
AA sequence
>Lus10021979 pacid=23160209 polypeptide=Lus10021979 locus=Lus10021979.g ID=Lus10021979.BGIv1.0 annot-version=v1.0
MKNSTTMTTHHLLLLLLANLPLIIIFVVLGVGVQPANSCRVLLDRPLPDNDLRPKNETLPANIQQKLPLPTNNGSVAAAVAGAAPAKYRTPPPPPAEGEP
SISICRSWSPPGSHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021979 0 1
AT3G56230 BTB/POZ domain-containing prot... Lus10017414 1.4 0.7957
Lus10000292 2.8 0.6808
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Lus10042395 6.9 0.7368
AT5G59540 2-oxoglutarate (2OG) and Fe(II... Lus10013315 10.0 0.7240
AT2G39040 Peroxidase superfamily protein... Lus10021957 10.7 0.7141
AT5G59190 subtilase family protein (.1) Lus10040251 11.0 0.7224
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10022104 12.7 0.6916
AT5G53190 SWEET3, AtSWEET... Nodulin MtN3 family protein (.... Lus10014932 18.8 0.7285
Lus10008841 19.7 0.6699
Lus10020530 20.2 0.6275

Lus10021979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.