Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004101 [exp] 175 / 1e-55 ND / Lus10004837 [exp] 172 / 7e-54 ND / Lus10010051 [exp] 173 / 2e-53 ND / Lus10017784 [exp] 171 / 3e-53 ND / Lus10027066 [exp] 121 / 8e-37 ND / Lus10013511 [exp] 123 / 8e-36 ND / Lus10042630 [exp] 119 / 8e-36 ND / Lus10002504 [exp] 116 / 9e-34 ND / Lus10009721 [exp] 117 / 2e-33 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021990 pacid=23160298 polypeptide=Lus10021990 locus=Lus10021990.g ID=Lus10021990.BGIv1.0 annot-version=v1.0 ATGAAGTTGTTCGTCATTTGGGAGAAACCATATAGGAAGTTGAACACGACGGTCAGCTTATGGGCTGTTGAGCTACTAGTTGAAGATCGGAAGTTTGTGA GTTCATGCACGTGTGTGATCCAGAGTACAAAGGGGCTTCCTTGTAGATGCGAAGTTCGGAGATGTATCGAAGAGGACAGGTTGCTGTACAGGAGACAACT ACATCGGTTTTGTGCTACGTTGGACTGTATAGAAGCACACGTTCGCACTGCCACGAGACTCCTCCAGTCTCAGCTACATCCAGAGGCTGAGAGTCTTCAT GACCCGAAGACACCTGATGCTCCGAAAGGCCAACCTCCTAGACGACAGTATGCAAGGGAACCGTAA
AA sequence Show only first row Show all	>Lus10021990 pacid=23160298 polypeptide=Lus10021990 locus=Lus10021990.g ID=Lus10021990.BGIv1.0 annot-version=v1.0 MKLFVIWEKPYRKLNTTVSLWAVELLVEDRKFVSSCTCVIQSTKGLPCRCEVRRCIEEDRLLYRRQLHRFCATLDCIEAHVRTATRLLQSQLHPEAESLH DPKTPDAPKGQPPRRQYAREP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021990 [exp]	0	1
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10041682 [exp]	1.0	0.9993
					Lus10026021 [exp]	2.0	0.8066
AT5G45550		MOB1-like	MOB1-like, Mob1/phocein family...		Lus10007595 [exp]	2.4	0.8758
AT1G23980			RING/U-box superfamily protein...		Lus10022223 [exp]	5.4	0.7408
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10024903 [exp]	7.3	0.8772
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	12.8	0.7911
AT3G54200			Late embryogenesis abundant (L...		Lus10006764 [exp]	14.1	0.7911
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10006893 [exp]	15.2	0.7911
					Lus10008001 [exp]	16.2	0.7911
AT1G63640			P-loop nucleoside triphosphate...		Lus10009028 [exp]	17.2	0.7911

Compare expression of checked genes

Lus10021990 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.