Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04590 42 / 8e-06 AT-hook AT hook motif DNA-binding family protein (.1.2) AT2G45850 38 / 0.0002 AT-hook AT hook motif DNA-binding family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006573 [exp] 60 / 2e-12 AT3G04590 181 / 1e-55 AT hook motif DNA-binding family protein (.1.2) Lus10005518 [exp] 55 / 3e-10 AT3G04590 238 / 9e-75 AT hook motif DNA-binding family protein (.1.2) Lus10030962 [exp] 40 / 6e-05 AT4G17950 235 / 2e-73 AT hook motif DNA-binding family protein (.1) Lus10040085 [exp] 40 / 6e-05 AT4G17950 241 / 9e-76 AT hook motif DNA-binding family protein (.1) Lus10000315 [exp] 39 / 0.0001 AT2G33620 228 / 4e-72 AT hook motif DNA-binding family protein (.1.2.3.4) Lus10011067 [exp] 39 / 0.0001 AT2G33620 225 / 4e-71 AT hook motif DNA-binding family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G014200 [exp] 43 / 4e-06 AT3G04590 181 / 2e-53 AT hook motif DNA-binding family protein (.1.2) Potri.013G044000 [exp] 42 / 9e-06 AT3G04590 171 / 2e-49 AT hook motif DNA-binding family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022008 pacid=23160251 polypeptide=Lus10022008 locus=Lus10022008.g ID=Lus10022008.BGIv1.0 annot-version=v1.0 ATGGACGATCAGAGTGTTGGGGGAGGAATTTGTGGACCTCTTATTGCTGCAAGTGATGTTCAGGTAATTGTTGGGACATACACGCTTGACAACAGAAAGT ATGCCAGTACTGGATATAGACCAGATGATTCCCGGAGTAGGTTGATATCCCCAATTGCTAGAGCATCTGTACCCAGTGGACATGATGACCAACATCAAAC AGGTTATCAAACTTTGGGAGGAATGCCATCCATGAATCAGAAGATGTGA
AA sequence Show only first row Show all	>Lus10022008 pacid=23160251 polypeptide=Lus10022008 locus=Lus10022008.g ID=Lus10022008.BGIv1.0 annot-version=v1.0 MDDQSVGGGICGPLIAASDVQVIVGTYTLDNRKYASTGYRPDDSRSRLISPIARASVPSGHDDQHQTGYQTLGGMPSMNQKM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022008 [exp]	0	1
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10003147 [exp]	1.7	0.9845
AT1G14540			Peroxidase superfamily protein...		Lus10000003 [exp]	3.7	0.9777
AT1G17860			Kunitz family trypsin and prot...		Lus10013732 [exp]	5.9	0.9692
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10019800 [exp]	7.1	0.9555
AT1G14540			Peroxidase superfamily protein...		Lus10009904 [exp]	7.3	0.9764
AT1G17860			Kunitz family trypsin and prot...		Lus10011090 [exp]	8.5	0.9658
AT3G19615			unknown protein		Lus10031599 [exp]	8.5	0.9719
AT1G73990		SPPA1, SPPA	signal peptide peptidase (.1)		Lus10013332 [exp]	8.9	0.9566
AT1G17860			Kunitz family trypsin and prot...		Lus10039208 [exp]	9.6	0.9518
AT4G35160			O-methyltransferase family pro...		Lus10006692 [exp]	11.5	0.9567

Compare expression of checked genes

Lus10022008 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.