Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14100 68 / 3e-15 ABCI11, ATNAP14 ARABIDOPSIS THALIANANON-INTRINSIC ABC PROTEIN 14, ATP-binding cassette I11, non-intrinsic ABC protein 14 (.1) AT1G65410 37 / 0.0004 ABCI13, TGD3, ATNAP11 TRIGALACTOSYLDIACYLGLYCEROL 3, ATP-binding cassette I13, non-intrinsic ABC protein 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035195 [exp] 77 / 1e-18 AT5G14100 333 / 2e-115 ARABIDOPSIS THALIANANON-INTRINSIC ABC PROTEIN 14, ATP-binding cassette I11, non-intrinsic ABC protein 14 (.1) Lus10032025 [exp] 77 / 2e-18 AT5G14100 303 / 1e-103 ARABIDOPSIS THALIANANON-INTRINSIC ABC PROTEIN 14, ATP-binding cassette I11, non-intrinsic ABC protein 14 (.1) Lus10020188 [exp] 37 / 0.0004 AT1G65410 500 / 2e-179 TRIGALACTOSYLDIACYLGLYCEROL 3, ATP-binding cassette I13, non-intrinsic ABC protein 11 (.1) Lus10026992 [exp] 37 / 0.0005 AT1G65410 476 / 2e-169 TRIGALACTOSYLDIACYLGLYCEROL 3, ATP-binding cassette I13, non-intrinsic ABC protein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G067804 [exp] 74 / 2e-17 AT5G14100 346 / 1e-120 ARABIDOPSIS THALIANANON-INTRINSIC ABC PROTEIN 14, ATP-binding cassette I11, non-intrinsic ABC protein 14 (.1) Potri.002G212701 [exp] 36 / 0.001 AT1G65410 483 / 2e-172 TRIGALACTOSYLDIACYLGLYCEROL 3, ATP-binding cassette I13, non-intrinsic ABC protein 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00005 [flax] [poplar] ABC_tran ABC transporter
Representative CDS sequence Show only first row Show all	>Lus10022035 pacid=23160258 polypeptide=Lus10022035 locus=Lus10022035.g ID=Lus10022035.BGIv1.0 annot-version=v1.0 ATGATCACCGTCGCCAATCTATTTACGTTGGTTCTGAATGGAATATCTTTGGATAAAGATCCTCAGTCTCTGAGTGGTGGACATAAGCGTAGACTTGCCC TGGCAATTCAATTAGCGAGTATTGAAGAACTTGGTGCTTATGTACAAGTACCAGATTTACTGATACTGGATGAGCCTCTTGCTGGTCTTGGTATGCACTC TTGTGATGAGCAACCAAGCTAG
AA sequence Show only first row Show all	>Lus10022035 pacid=23160258 polypeptide=Lus10022035 locus=Lus10022035.g ID=Lus10022035.BGIv1.0 annot-version=v1.0 MITVANLFTLVLNGISLDKDPQSLSGGHKRRLALAIQLASIEELGAYVQVPDLLILDEPLAGLGMHSCDEQPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14100		ABCI11, ATNAP14	ARABIDOPSIS THALIANANON-INTRIN...		Lus10022035 [exp]	0	1

Compare expression of checked genes

Lus10022035 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.