Lus10022042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008093 103 / 4e-27 AT2G32235 76 / 2e-15 unknown protein
Lus10013126 96 / 2e-24 AT2G32235 68 / 1e-12 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022042 pacid=23160220 polypeptide=Lus10022042 locus=Lus10022042.g ID=Lus10022042.BGIv1.0 annot-version=v1.0
ATGACTATCAATCTTCTCTATCACGGACCCAAGCCTTCCTCCCGTTCCTCCTATCAATCGTCCGACGTGACTCTACGTCGAGGACTTCCAGACTTGCCCG
GGTTCCTAATGCATCTTGTTAGATACGGATTTCAAGCCAAGTTCATCACCATTGAAGCTCTCCGGAATGACAAATGTCTCACCGGAAGTCGTCTCTGTAA
CTTAAGGAAGATGAATGATGACGGTCCAGAATTTTTCAGCGACGGTAGCGACCAAGCTCTCCTCAGCGGCGGGAGTGGAGGCAGTCCGGCGACCGTGGAC
GACGGCCAGGCGGAGGAATCGTTTGTCTCGACATTTCTGATCCCGTCCGGTGGCGGTGATTGGCGAGTTAGGTCTTATGAGCAAGTCCCGACGTCCGATC
CAGAGATCAGCGAAGGTGATCGGCGGAGATTAGGATTGGCTGCGGATTCCGGCTAA
AA sequence
>Lus10022042 pacid=23160220 polypeptide=Lus10022042 locus=Lus10022042.g ID=Lus10022042.BGIv1.0 annot-version=v1.0
MTINLLYHGPKPSSRSSYQSSDVTLRRGLPDLPGFLMHLVRYGFQAKFITIEALRNDKCLTGSRLCNLRKMNDDGPEFFSDGSDQALLSGGSGGSPATVD
DGQAEESFVSTFLIPSGGGDWRVRSYEQVPTSDPEISEGDRRRLGLAADSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022042 0 1
AT2G38750 ANNAT4 annexin 4 (.1) Lus10024171 3.5 0.9197
AT2G12646 PLATZ transcription factor fam... Lus10038103 7.2 0.8180
AT1G64960 HEB1 hypersensitive to excess boron... Lus10025197 9.2 0.8974
AT1G64960 HEB1 hypersensitive to excess boron... Lus10025198 9.3 0.8756
AT2G37240 Thioredoxin superfamily protei... Lus10029111 10.0 0.8730
AT1G76590 PLATZ transcription factor fam... Lus10014396 13.4 0.8490
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Lus10031677 18.7 0.8556
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10037995 21.5 0.8083
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Lus10027394 23.7 0.8480
AT4G38580 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPREN... Lus10014120 26.1 0.8524

Lus10022042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.