Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000267 [exp] 127 / 3e-39 ND / Lus10006574 [exp] 58 / 4e-11 AT3G04580 957 / 0.0 ETHYLENE INSENSITIVE 4, Signal transduction histidine kinase, hybrid-type, ethylene sensor (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G072400 [exp] 59 / 1e-11 AT4G40020 219 / 3e-63 Myosin heavy chain-related protein (.1) Potri.007G096600 [exp] 53 / 1e-09 AT4G40020 205 / 6e-58 Myosin heavy chain-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022051 pacid=23160302 polypeptide=Lus10022051 locus=Lus10022051.g ID=Lus10022051.BGIv1.0 annot-version=v1.0 ATGGTGGCGGGACATCCATACAACAGGCTCACCGAATCAATACCCACCGGCAAAGTAGCCGACGTGTTCGCAGAGTTGAACTTCACCGTGGAAGCGCTGA CGATCTCCAGCGAGGATCTCAAGGTCAAGGAGAAGGCGATCAGCGAGCTGACGACGGAGGTGGTGAGCTCGAAGCAATCGCAGGCGAAATTGGTGAATGA TTTGGGAAAAGCGAAGTTCACCGAGGATGATAGTCTGGATCGTTGTCGACAAAGATGA
AA sequence Show only first row Show all	>Lus10022051 pacid=23160302 polypeptide=Lus10022051 locus=Lus10022051.g ID=Lus10022051.BGIv1.0 annot-version=v1.0 MVAGHPYNRLTESIPTGKVADVFAELNFTVEALTISSEDLKVKEKAISELTTEVVSSKQSQAKLVNDLGKAKFTEDDSLDRCRQR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022051 [exp]	0	1
AT1G62700	NAC	ANAC026, VND5	VASCULAR RELATED NAC-DOMAIN PR...		Lus10004338 [exp]	3.9	0.7429
AT3G51710			D-mannose binding lectin prote...		Lus10009088 [exp]	6.6	0.7455
AT1G49170			Protein of unknown function (D...		Lus10042819 [exp]	7.5	0.7669
AT4G05400			copper ion binding (.1.2)		Lus10031070 [exp]	12.3	0.7277
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10029123 [exp]	24.2	0.7600
					Lus10013622 [exp]	26.6	0.7094
AT1G64060		RBOHAP108, ATRB...	ARABIDOPSIS THALIANA RESPIRATO...		Lus10028755 [exp]	34.3	0.6841
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10035930 [exp]	39.2	0.7002
AT3G02250			O-fucosyltransferase family pr...		Lus10036833 [exp]	42.2	0.7389
AT1G62760			Plant invertase/pectin methyle...		Lus10032232 [exp]	55.0	0.6211

Compare expression of checked genes

Lus10022051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.