Lus10022054 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022056 205 / 2e-70 ND 36 / 0.002
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022054 pacid=23160215 polypeptide=Lus10022054 locus=Lus10022054.g ID=Lus10022054.BGIv1.0 annot-version=v1.0
ATGGCCAGTGACATTGTGACCTTGCGGAACTTTCCAATTGATCGACCAACTGGTGCCTCTATCTGCAGCTTCTCCATGCCTGGAAGGTTGGCAATCCGGC
GACTCCCGACACCTATTTCACTTTTGGCACCCTCTGGTGCGACGAGGAGGGAACCACTGTGGAGGTCACCTCATTTCGCCGTCATGCTGACATTATCAGT
GCGCGTGTTTCTGTCGGGTCGGTATACACGGTTCGCGATTTCGGATGTCGCGCAGTCAATACTGAGCTTCATCCTTCCATCGCCTTTTGAGTCTGGTGCT
TACTATGTCGTTTAA
AA sequence
>Lus10022054 pacid=23160215 polypeptide=Lus10022054 locus=Lus10022054.g ID=Lus10022054.BGIv1.0 annot-version=v1.0
MASDIVTLRNFPIDRPTGASICSFSMPGRLAIRRLPTPISLLAPSGATRREPLWRSPHFAVMLTLSVRVFLSGRYTRFAISDVAQSILSFILPSPFESGA
YYVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022054 0 1
Lus10022056 1.0 0.9546
AT1G16130 WAKL2 wall associated kinase-like 2 ... Lus10034085 5.5 0.5945
Lus10025539 26.8 0.5817
AT4G00310 MEE46, EDA8 MATERNAL EFFECT EMBRYO ARREST ... Lus10005116 52.4 0.5965
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10016686 73.4 0.5731
AT3G24820 BSD domain-containing protein ... Lus10025929 117.3 0.5591
AT1G17400 unknown protein Lus10027660 129.0 0.5452
AT1G16445 S-adenosyl-L-methionine-depend... Lus10031751 226.0 0.5271

Lus10022054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.