Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22500 61 / 5e-12 ATECP31 LATE EMBRYOGENESIS ABUNDANT PROTEIN ECP31, Seed maturation protein (.1) AT3G22490 58 / 7e-11 Seed maturation protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042604 [exp] 150 / 2e-46 AT3G22490 234 / 5e-77 Seed maturation protein (.1) Lus10010553 [exp] 65 / 1e-13 AT3G22490 302 / 1e-103 Seed maturation protein (.1) Lus10006121 [exp] 59 / 4e-11 AT3G22490 311 / 1e-107 Seed maturation protein (.1) Lus10019001 [exp] 41 / 7e-05 AT3G22490 262 / 3e-88 Seed maturation protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G048000 [exp] 50 / 3e-08 AT3G22490 229 / 4e-75 Seed maturation protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04927 [flax] [poplar] SMP Seed maturation protein
Representative CDS sequence Show only first row Show all	>Lus10022058 pacid=23160261 polypeptide=Lus10022058 locus=Lus10022058.g ID=Lus10022058.BGIv1.0 annot-version=v1.0 ATGAGCCAACAACAGCCAAGCAGGCCGCAAGCCATGGACACCGATCGCAACCAGGCTACTGCCATCAAGTACGGCGACGTTTTCACCGTCCAGGGAGATC TGGCCTGTAAACCAGTGGCCCCTGGTGACGCTGCCGCCTTGCAAGCAGCGGAAGCCCGAGTTCTCGGCCAGACTCCGGCTAGTGGGCCCGGTGCGGTCAT GGGATCCGCTGCCACCGTCAATTACCACGCTGGTGCTGTTGACCGTAAGCAAACCACCGACTCGGTTAGAGACCAAGGCGTCTCCGTCTCCGCTGCCGAT GTTGCCGGTGCTCGCGTCGTTACCGAAACGGTCGCTGGCCAGTTGGGAACTCCAATTGAGATGGACTGA
AA sequence Show only first row Show all	>Lus10022058 pacid=23160261 polypeptide=Lus10022058 locus=Lus10022058.g ID=Lus10022058.BGIv1.0 annot-version=v1.0 MSQQQPSRPQAMDTDRNQATAIKYGDVFTVQGDLACKPVAPGDAAALQAAEARVLGQTPASGPGAVMGSAATVNYHAGAVDRKQTTDSVRDQGVSVSAAD VAGARVVTETVAGQLGTPIEMD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22490			Seed maturation protein (.1)		Lus10022058 [exp]	0	1
AT2G46680	HD	ATHB7, ATHB-7	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10008840 [exp]	2.4	0.9730
AT3G47250			Plant protein of unknown funct...		Lus10020563 [exp]	3.0	0.9727
AT1G03620			ELMO/CED-12 family protein (.1...		Lus10039805 [exp]	3.6	0.9617
AT5G41810			unknown protein		Lus10003901 [exp]	4.2	0.9743
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10021299 [exp]	4.5	0.9672
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Lus10004222 [exp]	4.9	0.9680
AT2G02850		ARPN	plantacyanin (.1)		Lus10022800 [exp]	5.7	0.9710
AT3G19990			unknown protein		Lus10038848 [exp]	6.2	0.9489
AT3G44710			Plant protein of unknown funct...		Lus10020562 [exp]	6.5	0.9699
AT4G34000	bZIP	AtABF3, ABF3, D...	DC3 PROMOTER-BINDING FACTOR 5,...		Lus10019850 [exp]	7.3	0.9529

Compare expression of checked genes

Lus10022058 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.