Lus10022064 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G14250 79 / 2e-18 RING/U-box superfamily protein (.1)
AT3G53690 76 / 2e-17 RING/U-box superfamily protein (.1)
AT4G19670 68 / 2e-14 RING/U-box superfamily protein (.1.2)
AT2G26135 61 / 5e-12 RING/U-box protein with C6HC-type zinc finger (.1)
AT3G45580 59 / 3e-11 RING/U-box protein with C6HC-type zinc finger (.1)
AT5G37560 58 / 9e-11 RING/U-box superfamily protein (.1)
AT5G60250 58 / 9e-11 zinc finger (C3HC4-type RING finger) family protein (.1)
AT3G45470 56 / 1e-10 IBR domain containing protein (.1)
AT3G43750 54 / 2e-09 RING/U-box protein with C6HC-type zinc finger domain (.1)
AT3G45540 54 / 2e-09 RING/U-box protein with C6HC-type zinc finger (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042610 164 / 8e-51 AT3G53690 113 / 9e-17 RING/U-box superfamily protein (.1)
Lus10022063 107 / 1e-29 AT3G53690 175 / 3e-53 RING/U-box superfamily protein (.1)
Lus10026104 79 / 2e-18 AT3G14250 240 / 1e-77 RING/U-box superfamily protein (.1)
Lus10000412 77 / 1e-17 AT3G14250 228 / 9e-73 RING/U-box superfamily protein (.1)
Lus10024093 70 / 3e-15 AT3G14250 209 / 2e-66 RING/U-box superfamily protein (.1)
Lus10036202 59 / 4e-11 AT4G19670 624 / 0.0 RING/U-box superfamily protein (.1.2)
Lus10038341 58 / 9e-11 AT4G19670 607 / 0.0 RING/U-box superfamily protein (.1.2)
Lus10036127 55 / 8e-10 AT5G60250 338 / 9e-108 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10036128 54 / 2e-09 AT5G60250 410 / 1e-136 zinc finger (C3HC4-type RING finger) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G064400 85 / 2e-20 AT3G53690 273 / 1e-89 RING/U-box superfamily protein (.1)
Potri.003G187700 80 / 8e-19 AT3G14250 242 / 8e-79 RING/U-box superfamily protein (.1)
Potri.001G037200 78 / 4e-18 AT3G14250 240 / 3e-78 RING/U-box superfamily protein (.1)
Potri.019G093600 58 / 4e-11 AT3G53690 158 / 7e-47 RING/U-box superfamily protein (.1)
Potri.006G104700 58 / 6e-11 AT5G60250 424 / 4e-141 zinc finger (C3HC4-type RING finger) family protein (.1)
Potri.006G123500 57 / 1e-10 AT3G53690 163 / 1e-48 RING/U-box superfamily protein (.1)
Potri.013G120300 56 / 2e-10 AT3G53690 158 / 7e-47 RING/U-box superfamily protein (.1)
Potri.009G150100 56 / 4e-10 AT5G60250 378 / 6e-124 zinc finger (C3HC4-type RING finger) family protein (.1)
Potri.017G050100 50 / 5e-08 AT4G01020 1719 / 0.0 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
Potri.015G117600 48 / 2e-07 AT4G19670 661 / 0.0 RING/U-box superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10022064 pacid=23160277 polypeptide=Lus10022064 locus=Lus10022064.g ID=Lus10022064.BGIv1.0 annot-version=v1.0
ATGATTGCTATTCTGGATTGCTCTGTTTTGCTCATCAACGACGCCGCCGTCAACAAGTGTGCGTGTCCGAGCTGCAAGAGGGCGATTTGTGTGAAGTGCA
AGTGTCCGTGGCATAAGAGGATGGATTGCAGGACGTACAAGGATTTGAAACGACAAGGAAAGCTGCAGGATAAGAAGCAGCTGGAGCGGCTTGCTGGATT
GAAAAAGTGGAGGAAGTGCCCTCATTGCAATTTCTACGTTGGAAAAGACGATGGCTGCAGCTATGTTAAATGCAGGTGCGTACCGCATGTTCCTTCAAAA
GGAAAACAAAAAGAAAAGAATTTCCAAATGGCTAGTGATTTTAGTGGGAACGAAGAATAA
AA sequence
>Lus10022064 pacid=23160277 polypeptide=Lus10022064 locus=Lus10022064.g ID=Lus10022064.BGIv1.0 annot-version=v1.0
MIAILDCSVLLINDAAVNKCACPSCKRAICVKCKCPWHKRMDCRTYKDLKRQGKLQDKKQLERLAGLKKWRKCPHCNFYVGKDDGCSYVKCRCVPHVPSK
GKQKEKNFQMASDFSGNEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14250 RING/U-box superfamily protein... Lus10022064 0 1
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 2.6 0.9586
AT5G20260 Exostosin family protein (.1) Lus10039980 3.7 0.9586
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 4.6 0.9586
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 5.3 0.9586
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013919 5.9 0.9459
AT1G18010 Major facilitator superfamily ... Lus10009413 6.5 0.9326
AT1G26730 EXS (ERD1/XPR1/SYG1) family pr... Lus10004284 8.8 0.9231
Lus10013881 8.9 0.9150
AT5G20630 ATGER3, GLP3A, ... GERMIN-LIKE PROTEIN 3, ARABIDO... Lus10015645 8.9 0.8848
Lus10030782 9.0 0.9053

Lus10022064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.