Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 89 / 8e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 82 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 72 / 3e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 50 / 4e-08 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G09370 44 / 4e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G55260 44 / 2e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G64080 42 / 4e-05 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48140 41 / 6e-05 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G43720 41 / 9e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042611 [exp] 179 / 6e-58 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 92 / 5e-24 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 92 / 1e-23 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 91 / 3e-23 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 88 / 9e-22 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 84 / 2e-20 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 74 / 1e-16 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 73 / 1e-16 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 72 / 3e-16 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085400 [exp] 98 / 4e-26 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 93 / 3e-24 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 92 / 6e-24 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 90 / 3e-23 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 83 / 4e-20 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 81 / 2e-19 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 79 / 4e-19 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 74 / 7e-17 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 53 / 6e-09 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 50 / 5e-08 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10022065 pacid=23160280 polypeptide=Lus10022065 locus=Lus10022065.g ID=Lus10022065.BGIv1.0 annot-version=v1.0 ATGGCCGTGATTAGGAATTTGTCAATTCTGGTCATCTCTCTCGCCGTCGTCGGGACGGCTCTGTTTCCGACAGGAGCCACGGCGCAGTCCAATGGCTGCA CGAGCACGCTTGTGAGCCTCTCCCCTTGCCTTAATTACATCACCGGCAACTCTTCCTCCCCGTCTTCTTCCTGCTGCGCCCAGCTCGGCACCGTCGTCAA GTCCCAGCCGGAATGCCTCTGCCAGGTCATCAACGGCGGCGGTGGCAACCTCGGTATTAATGTGAACGAGACTCAAGCTCTGGCTCTTCCCGCTGCCTGT AAAGTCCAGACCCCACCTACCAGTCAATGCAATGCGGCTGGATCGCCATCTGGGTCACCGAAGTCGCCGTCAGGGACAGGAGGCGGGTCAACGGGTTCAT CGCCGGACGGGACATCATCGTCATCTGCAGATGGGAGCTCTGCAAAGTTGACTTTCTCCCTGGTGTTCCTGATGCTCTTTGCTGCTTCCTACTCTTCAAT CTAA
AA sequence Show only first row Show all	>Lus10022065 pacid=23160280 polypeptide=Lus10022065 locus=Lus10022065.g ID=Lus10022065.BGIv1.0 annot-version=v1.0 MAVIRNLSILVISLAVVGTALFPTGATAQSNGCTSTLVSLSPCLNYITGNSSSPSSSCCAQLGTVVKSQPECLCQVINGGGGNLGINVNETQALALPAAC KVQTPPTSQCNAAGSPSGSPKSPSGTGGGSTGSSPDGTSSSSADGSSAKLTFSLVFLMLFAASYSSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	0	1
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	1.0	0.9775
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	2.0	0.9639
					Lus10033358 [exp]	4.0	0.9314
AT2G23810		TET8	tetraspanin8 (.1)		Lus10023216 [exp]	4.6	0.9332
					Lus10014682 [exp]	6.0	0.9140
AT4G23340			2-oxoglutarate (2OG) and Fe(II...		Lus10009663 [exp]	6.5	0.9171
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	8.1	0.9048
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10033898 [exp]	8.9	0.9136
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	9.5	0.9312
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10040341 [exp]	10.6	0.8983

Compare expression of checked genes

Lus10022065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.