Lus10022067 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G48140 103 / 4e-28 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G05450 94 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22620 64 / 3e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G48130 44 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22600 43 / 5e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042613 214 / 7e-71 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10014683 124 / 9e-34 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10006906 117 / 2e-33 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10010575 107 / 2e-28 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10021911 67 / 3e-13 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10041196 67 / 3e-13 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G212000 117 / 9e-33 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.002G050200 105 / 7e-28 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.010G085200 98 / 6e-25 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.008G155200 79 / 8e-18 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10022067 pacid=23160278 polypeptide=Lus10022067 locus=Lus10022067.g ID=Lus10022067.BGIv1.0 annot-version=v1.0
ATGATGGAATTGAAAGGACTCGTAATTACAATCATCTTCATAATTTGGTCGACCGCTGGTGTTTCAAAGGCGCAGATTACCACGCCGTGCACGACTTCCA
TGGTCAGCAGCTTCACTCCTTGCATCAATTTCATCACCGGAAGCAGCAGCAACGGCACTACTTCGCCCACCACAGGATGCTGTGATGCTCTGAAGGAACT
TGTTGCGGCCAGCATGGACTGCGCTTGCCTTGTCGTTACGGCCAATGTACCGATTCAGCTTCCCTTTGTTCCTCCTCTGTCCATCTCCCTCCCCAGGGCC
TGCAAAATGGGAGTTCCCTTGCGCTGCAAAGCTTCGGTGTCTCCACTGGCAGCGCCGGGGCCTGCTCTGTTGCGGACTGCTACTGATGCACCTGCTCCTG
CCCCACAATGTAGGAAATTAATTTGTTTGCTTTTCTTTGTCAAACTCAGAGTTCCAATTTTCCTGTGTTTTTTTGTGGCAGCAGCTTCAACCGCAGTAGC
AGTAGACTCTCCGGCACCAGCTCCGGATTTAACGGCGACCCAGCCGGAAGAAGAAAACCGGACAACCACCGTCTGGGGGCGACCTTTTGTGAACATCTCT
GCTTCTGTTGTGTCGCACGACGTGCCACATTGTGTGGCTTCTCTACTTTTCATAGCTGTGGCAATCCTACTCGCCGCACATTGA
AA sequence
>Lus10022067 pacid=23160278 polypeptide=Lus10022067 locus=Lus10022067.g ID=Lus10022067.BGIv1.0 annot-version=v1.0
MMELKGLVITIIFIIWSTAGVSKAQITTPCTTSMVSSFTPCINFITGSSSNGTTSPTTGCCDALKELVAASMDCACLVVTANVPIQLPFVPPLSISLPRA
CKMGVPLRCKASVSPLAAPGPALLRTATDAPAPAPQCRKLICLLFFVKLRVPIFLCFFVAAASTAVAVDSPAPAPDLTATQPEEENRTTTVWGRPFVNIS
ASVVSHDVPHCVASLLFIAVAILLAAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G48140 EDA4 embryo sac development arrest ... Lus10022067 0 1
AT5G37690 SGNH hydrolase-type esterase s... Lus10039877 4.9 0.8795
AT5G37690 SGNH hydrolase-type esterase s... Lus10018641 13.4 0.8613
AT5G44550 Uncharacterised protein family... Lus10000781 13.5 0.8765
AT1G11920 Pectin lyase-like superfamily ... Lus10018430 13.6 0.7990
AT3G24570 Peroxisomal membrane 22 kDa (M... Lus10011679 18.0 0.8771
AT2G40370 LAC5 laccase 5 (.1) Lus10007531 21.6 0.8651
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10003754 22.2 0.7843
AT5G58860 CYP86A1 "cytochrome P450, family 86, s... Lus10040687 24.5 0.8476
AT3G11780 MD-2-related lipid recognition... Lus10021256 25.1 0.8664
AT1G16060 AP2_ERF ADAP ARIA-interacting double AP2 do... Lus10001553 31.9 0.8551

Lus10022067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.