Lus10022087 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022087 pacid=23160281 polypeptide=Lus10022087 locus=Lus10022087.g ID=Lus10022087.BGIv1.0 annot-version=v1.0
ATGATTGATTACCTCCTCATGTATCCCCTTACCTCTCTAATCCTCTATCCTCGATTTGGGGCTGATCGGATTTGCCTCCACGTACACATGATCGGTTTCC
CTCCTCTTCTGGGAGGCAGTCGTCGCTTACCTAGGGGCTCTGTCAGTTTGACGAGCAAGTCTGATAGATTAGATTCATCAAAAGAAACCCAAGAAGCAAA
AGTCCAAAAGAAATCACACAAGAGCGAGGGAGTCGATATGCATACTCCTTTTTCTCGTGTCTATATATGTCTGATCACTAGGAGAACAAAACCAAAAGAA
CCTTCCCAATCTGCTCCAAAACTTCATACTGCTCCATCAGAAGAAATCCTTATGCTTTCAAACACCTAA
AA sequence
>Lus10022087 pacid=23160281 polypeptide=Lus10022087 locus=Lus10022087.g ID=Lus10022087.BGIv1.0 annot-version=v1.0
MIDYLLMYPLTSLILYPRFGADRICLHVHMIGFPPLLGGSRRLPRGSVSLTSKSDRLDSSKETQEAKVQKKSHKSEGVDMHTPFSRVYICLITRRTKPKE
PSQSAPKLHTAPSEEILMLSNT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022087 0 1
AT4G24460 CLT2 CRT (chloroquine-resistance tr... Lus10028858 2.8 0.9426
AT3G06390 Uncharacterised protein family... Lus10012808 4.7 0.9275
Lus10034460 7.4 0.8908
AT3G04600 Nucleotidylyl transferase supe... Lus10018331 7.9 0.9201
AT1G03055 unknown protein Lus10018752 10.1 0.8800
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10027940 10.4 0.9121
AT4G37850 bHLH bHLH025 basic helix-loop-helix (bHLH) ... Lus10019247 12.8 0.8701
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10012041 13.4 0.9054
AT4G12840 Protein of unknown function (D... Lus10041107 14.1 0.9143
AT1G54730 Major facilitator superfamily ... Lus10029960 17.2 0.9177

Lus10022087 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.