Lus10022090 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39350 87 / 7e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G44230 87 / 8e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 84 / 8e-19 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G04780 84 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G18485 82 / 4e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59600 81 / 1e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 81 / 1e-17 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G16470 79 / 3e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14850 80 / 4e-17 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G21300 79 / 6e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022094 247 / 2e-84 AT5G44230 92 / 3e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10001187 190 / 1e-55 AT3G23070 879 / 0.0 CRM family member 3A (.1)
Lus10005638 81 / 2e-18 AT5G40410 305 / 9e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022124 81 / 3e-18 AT2G20540 345 / 1e-116 mitochondrial editing factor 21 (.1)
Lus10002553 81 / 3e-18 AT2G22410 365 / 3e-122 SLOW GROWTH 1 (.1)
Lus10030225 81 / 8e-18 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013149 82 / 9e-18 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021229 82 / 1e-17 AT5G40410 662 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020743 81 / 1e-17 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G006400 87 / 2e-19 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G005400 85 / 5e-19 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G223900 84 / 1e-18 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G239600 84 / 1e-18 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G044700 84 / 1e-18 AT3G22690 582 / 0.0 unknown protein
Potri.003G058700 83 / 3e-18 AT1G15510 1113 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G019900 82 / 4e-18 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G077700 82 / 5e-18 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G068900 82 / 6e-18 AT3G20730 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G086900 82 / 6e-18 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10022090 pacid=23146500 polypeptide=Lus10022090 locus=Lus10022090.g ID=Lus10022090.BGIv1.0 annot-version=v1.0
ATGGTATCATTTGTGTTTAGCCTTGTGATACTTATTGGTAGAGTCAACAGATGGAATCTAATAAGAGATAATGTGTTTACCTGCTCATTTTGCAGGAATG
TTGGAGAGAAGTTGAAGCTGTCATCTTTCTTGAAACCTGAGACTTTGGCGGAGCATGTGACTTGTATGGTGGACCTTCTTGGAAGAGCTGGGCAGCGTGG
AAGGGCGTACAATCTGATGATGATGAATAATGCTGATGATGCGGTGAGTGATATTGGGATTTGGGGTGCTTTCCATGCAGCTTGTAGGGTTCATGGCAAT
GCAGAAATGGGTGAGATGACAGCCAGGCATCTTGGGGAAATGGATACCGAGGATTTGGGAAACAAGATTCTTTTGACAAATGCTTATGCTTCAAATAGTA
AACGGGATTCCGCTGAGAAGGTGCGGAAGACCATGGTAGAAAAAAAGACTGAAAAGAAGCCCTGGCTGCAGCTGGATTTTAGGTTGACTACCACCCTTTT
CAATACTTTTTTTGTTGGTTACGTGAACCTTTCCAATACTTTGGTGAAGTATCAAAGGATAAATTTTAGTCTCAAAACTCGTGGCTACGTACTACAACGG
CGGGAAGAAGATAAGAGGTTTGTTTTTGAGGGCTACTATTTGACGCCCTAA
AA sequence
>Lus10022090 pacid=23146500 polypeptide=Lus10022090 locus=Lus10022090.g ID=Lus10022090.BGIv1.0 annot-version=v1.0
MVSFVFSLVILIGRVNRWNLIRDNVFTCSFCRNVGEKLKLSSFLKPETLAEHVTCMVDLLGRAGQRGRAYNLMMMNNADDAVSDIGIWGAFHAACRVHGN
AEMGEMTARHLGEMDTEDLGNKILLTNAYASNSKRDSAEKVRKTMVEKKTEKKPWLQLDFRLTTTLFNTFFVGYVNLSNTLVKYQRINFSLKTRGYVLQR
REEDKRFVFEGYYLTP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10022090 0 1
AT2G20300 ALE2 Abnormal Leaf Shape 2, Protein... Lus10003827 5.7 0.7582
AT4G15560 AtCLA1, DXS, DX... 1-DEOXY-D-XYLULOSE 5-PHOSPHATE... Lus10033987 10.8 0.7981
Lus10026444 12.2 0.7266
AT1G45063 copper ion binding;electron ca... Lus10019405 12.4 0.7410
AT4G18260 Cytochrome b561/ferric reducta... Lus10020757 14.5 0.7353
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10007748 16.4 0.7384
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10043373 18.8 0.7369
AT2G30933 Carbohydrate-binding X8 domain... Lus10020765 20.2 0.7394
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10018674 20.8 0.7383
AT4G32285 ENTH/ANTH/VHS superfamily prot... Lus10043260 27.5 0.7359

Lus10022090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.