Lus10022093 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14820 142 / 2e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59200 140 / 2e-39 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G21470 134 / 3e-37 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G56310 130 / 1e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 130 / 2e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G77170 129 / 2e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G12770 129 / 4e-35 MEF22 mitochondrial editing factor 22 (.1)
AT1G05750 127 / 7e-35 PDE247, CLB19 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G37570 127 / 2e-34 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G40405 127 / 3e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001187 339 / 4e-109 AT3G23070 879 / 0.0 CRM family member 3A (.1)
Lus10010320 142 / 1e-39 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10024971 137 / 9e-38 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033858 136 / 1e-37 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020918 135 / 4e-37 AT2G29760 474 / 3e-159 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024876 135 / 7e-37 AT3G12770 886 / 0.0 mitochondrial editing factor 22 (.1)
Lus10031430 129 / 9e-36 AT5G06540 350 / 1e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026006 130 / 3e-35 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002288 130 / 3e-35 AT1G31430 689 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G086200 145 / 1e-40 AT4G14820 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G141200 140 / 2e-39 AT5G66520 407 / 1e-135 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G164100 137 / 2e-38 AT1G77170 553 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G108000 138 / 3e-38 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.016G029500 135 / 2e-37 AT3G56550 740 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 135 / 3e-37 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G003600 135 / 4e-37 AT5G66520 354 / 1e-114 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G087000 132 / 7e-37 AT5G66520 335 / 9e-109 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G191200 134 / 1e-36 AT5G48910 852 / 0.0 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G239600 133 / 2e-36 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10022093 pacid=23146498 polypeptide=Lus10022093 locus=Lus10022093.g ID=Lus10022093.BGIv1.0 annot-version=v1.0
ATGATTGCAGGTTATGGCAAGTGTGGTGCTGTCAAGGAGGCTAGAAATGTGTTTGGTTCCATACTAGAGCTGGATGCTTCTTGTTGGGCTGCAATGTTGG
CATGTTATGCTCAGAATGGATATGCCAAGGAAGCCATTGAGATGTATATGGAGATGAGAGTAGCAGAAGTCAAAATCACAGATGTGGCCATGGTTGGAGC
CGTCTCTGCTTGTACTCAGCTTGGAGATGCTGAGTTGGCAACCACATTGGCTGCAGACATAGAGGAAAGACACATTGACAGCGGGGTGATTGTATCAAAT
GCTTTGATCCACATGCAAGCCAAATGCGGTTCATTGGACTTGGCCTGGAAAGAATTCAGCGGAATGAAGTTTATAAGTGTAGTCACTTACAGTACTATCA
TGGCAGCCTTGGCAGACCATGGCAAGTCTAAGGAAGCTTTAGATATGTTCAAGAGCATGCAGGATGAAGGTTTGAGACCGAATCAAGTTACCTTTGTCAG
TGTTCTCAATGCTTGCAGCTATGGAGGTTTGGTGGAGGAAGGCTGA
AA sequence
>Lus10022093 pacid=23146498 polypeptide=Lus10022093 locus=Lus10022093.g ID=Lus10022093.BGIv1.0 annot-version=v1.0
MIAGYGKCGAVKEARNVFGSILELDASCWAAMLACYAQNGYAKEAIEMYMEMRVAEVKITDVAMVGAVSACTQLGDAELATTLAADIEERHIDSGVIVSN
ALIHMQAKCGSLDLAWKEFSGMKFISVVTYSTIMAALADHGKSKEALDMFKSMQDEGLRPNQVTFVSVLNACSYGGLVEEG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14820 Pentatricopeptide repeat (PPR)... Lus10022093 0 1
AT2G36660 PAB7 poly(A) binding protein 7 (.1) Lus10027733 19.2 0.7493
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10022094 49.1 0.7164
AT4G20020 unknown protein Lus10037713 86.3 0.6509
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10014279 118.9 0.6900

Lus10022093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.