Lus10022094 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04780 92 / 2e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G44230 92 / 4e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16470 88 / 6e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 88 / 9e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G18485 87 / 2e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33990 86 / 3e-20 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 85 / 7e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14850 84 / 1e-19 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 82 / 6e-19 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 82 / 7e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022090 278 / 6e-97 AT5G44230 88 / 5e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10001187 208 / 7e-63 AT3G23070 879 / 0.0 CRM family member 3A (.1)
Lus10020743 88 / 9e-21 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 88 / 1e-20 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022124 84 / 3e-20 AT2G20540 345 / 1e-116 mitochondrial editing factor 21 (.1)
Lus10005987 86 / 4e-20 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030225 86 / 4e-20 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010850 85 / 8e-20 AT5G60020 856 / 0.0 laccase 17 (.1)
Lus10002553 83 / 1e-19 AT2G22410 365 / 3e-122 SLOW GROWTH 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G223900 90 / 1e-21 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G119000 90 / 2e-21 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G239600 89 / 4e-21 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G155100 88 / 7e-21 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G010100 87 / 7e-21 AT4G16470 551 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G005400 87 / 2e-20 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G019900 87 / 2e-20 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G077700 87 / 2e-20 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 86 / 3e-20 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G083700 86 / 3e-20 AT3G22690 1050 / 0.0 unknown protein
PFAM info
Representative CDS sequence
>Lus10022094 pacid=23146455 polypeptide=Lus10022094 locus=Lus10022094.g ID=Lus10022094.BGIv1.0 annot-version=v1.0
ATGACTTGTGTGTACGGAATTAAGACTTTGGCGGAGCATGTGACTTATATGGTGGACCTTCTTGGAAGAGCTGGGCAGCTTAGAAGGGCGTACAATCTGA
TGATGATGAATAATGCTGATGATGCGGTGAGTGATATTGGGATCTGGGGTGCTTTCCATGCAGCTTGTAGGGTTCATGGCAATGCAGAAATGGGTGAGAT
GACAGCCAGGCATCTTGGGGAAATGGATACAGAGGATTTGGGAAACAAGATTCTTTTGACAAATGCTTATGCTTCAAATAGTAAACGGGATTCCGCTGAG
AAGGTGCGGAAGACCATGGTAGAAAAAAAGACTGAAAAGAAGCCCTGGCTGCAGCTGGATTTTAGGTTGACTACCACCCTTTTCAATACTTCTTTTGTTG
GTTACGTGACCCTTTCCAATACTTTGGTGAAGTATCAAAGGACAGGTTTCTAG
AA sequence
>Lus10022094 pacid=23146455 polypeptide=Lus10022094 locus=Lus10022094.g ID=Lus10022094.BGIv1.0 annot-version=v1.0
MTCVYGIKTLAEHVTYMVDLLGRAGQLRRAYNLMMMNNADDAVSDIGIWGAFHAACRVHGNAEMGEMTARHLGEMDTEDLGNKILLTNAYASNSKRDSAE
KVRKTMVEKKTEKKPWLQLDFRLTTTLFNTSFVGYVTLSNTLVKYQRTGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10022094 0 1
AT4G14820 Pentatricopeptide repeat (PPR)... Lus10022093 49.1 0.7164
AT4G33680 AGD2 ABERRANT GROWTH AND DEATH 2, P... Lus10000205 58.5 0.7560
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10014279 140.4 0.7086
AT1G10510 EMB2004 embryo defective 2004, RNI-lik... Lus10030829 221.6 0.7010

Lus10022094 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.