Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05860 42 / 7e-06 MADS MADS-box transcription factor family protein (.1.2.3) AT2G40210 38 / 0.0002 MADS AGL48 AGAMOUS-like 48 (.1) AT5G26580 37 / 0.0004 MADS AGL34 AGAMOUS-like-34 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022107 [exp] 55 / 3e-11 ND 71 / 6e-16 Lus10014883 [exp] 50 / 6e-09 AT5G48670 114 / 1e-29 AGAMOUS-like 80 (.1) Lus10022316 [exp] 50 / 6e-09 AT5G48670 131 / 2e-36 AGAMOUS-like 80 (.1) Lus10007711 [exp] 43 / 1e-06 AT5G48670 83 / 5e-20 AGAMOUS-like 80 (.1) Lus10007713 [exp] 41 / 5e-06 AT1G65330 74 / 1e-16 PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1) Lus10022325 [exp] 40 / 3e-05 AT1G65300 113 / 1e-30 PHERES2, AGAMOUS-like 38 (.1) Lus10029367 [exp] 39 / 7e-05 AT5G06500 88 / 1e-20 AGAMOUS-like 96 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002400 [exp] 47 / 1e-07 AT5G48670 222 / 4e-71 AGAMOUS-like 80 (.1) Potri.016G068132 [exp] 44 / 8e-07 AT5G48670 125 / 1e-34 AGAMOUS-like 80 (.1) Potri.006G201700 [exp] 41 / 1e-05 AT5G48670 120 / 2e-30 AGAMOUS-like 80 (.1) Potri.013G107600 [exp] 38 / 0.0001 AT1G22590 117 / 9e-34 AGAMOUS-like 87 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022100 pacid=23146481 polypeptide=Lus10022100 locus=Lus10022100.g ID=Lus10022100.BGIv1.0 annot-version=v1.0 ATGCCTAGAAAGAAAGTAAAGCTAATGTACATAGCAAACTCATCAGCCAGGAAGGCATCATTTAAGAAGTGGAAGAGCGGTCTAATGAAGAAAGTGAGAG CGCTAGCACCCTCTGCGACGTCCAAGCCTGCGCCATCATCAACAACCCGTACGATGAGGCGCAACCGCCGGATACTTGGTCGTCGACGAAGGGCGAGGTC TACCAGGTGCTGA
AA sequence Show only first row Show all	>Lus10022100 pacid=23146481 polypeptide=Lus10022100 locus=Lus10022100.g ID=Lus10022100.BGIv1.0 annot-version=v1.0 MPRKKVKLMYIANSSARKASFKKWKSGLMKKVRALAPSATSKPAPSSTTRTMRRNRRILGRRRRARSTRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022100 [exp]	0	1

Compare expression of checked genes

Lus10022100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.