Lus10022103 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54140 112 / 3e-33 TAF9, TAFII21 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011251 132 / 2e-41 AT1G54140 242 / 2e-82 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Lus10012411 132 / 5e-41 AT1G54140 239 / 2e-81 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Lus10001863 110 / 5e-34 AT1G54140 106 / 7e-31 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G168300 120 / 2e-36 AT1G54140 262 / 1e-90 TBP-ASSOCIATED FACTOR 9, TATA binding protein associated factor 21kDa subunit (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF02291 TFIID-31kDa Transcription initiation factor IID, 31kD subunit
Representative CDS sequence
>Lus10022103 pacid=23146452 polypeptide=Lus10022103 locus=Lus10022103.g ID=Lus10022103.BGIv1.0 annot-version=v1.0
ATGGCCGAAGGAGATGAGCAAATGCCAAGAGATGCGAAGATTTTCAAATCACTCTTGAAATCAATGGGTGTTGAAGACTACGAACCTCGTGTTATGCACC
AGTTCCTGGAGTTGTGGTATCGTTACTTTATGGATGTATTGACAGATGCTCAAGTTTACTCGGAGCATGCTGGCAAGTCTACTATCGACACTGAAAGTTG
TCTCTAG
AA sequence
>Lus10022103 pacid=23146452 polypeptide=Lus10022103 locus=Lus10022103.g ID=Lus10022103.BGIv1.0 annot-version=v1.0
MAEGDEQMPRDAKIFKSLLKSMGVEDYEPRVMHQFLELWYRYFMDVLTDAQVYSEHAGKSTIDTESCL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G54140 TAF9, TAFII21 TBP-ASSOCIATED FACTOR 9, TATA ... Lus10022103 0 1
AT3G50210 2-oxoglutarate (2OG) and Fe(II... Lus10041597 1.0 0.8748
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842 8.1 0.8251
AT5G19450 CPK8, CDPK19 calcium-dependent protein kina... Lus10030134 13.3 0.8487
AT5G45275 Major facilitator superfamily ... Lus10033280 15.3 0.8389
AT3G48200 unknown protein Lus10008827 15.7 0.8176
AT1G01320 Tetratricopeptide repeat (TPR)... Lus10020453 18.0 0.7513
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10004652 20.1 0.8263
AT3G59570 Ypt/Rab-GAP domain of gyp1p su... Lus10022963 27.3 0.7438
AT3G15200 Tetratricopeptide repeat (TPR)... Lus10031270 28.5 0.8052
AT5G48840 ATPTS, PANC ARABIDOPSIS THALIANA PANTOTHEN... Lus10038167 32.0 0.7044

Lus10022103 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.