Gene [FLAX] | FIBexDB

Lus10022107 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT5G48670	51 / 4e-08	MADS	FEM111, AGL80	AGAMOUS-like 80 (.1)
AT1G65330	45 / 3e-06	MADS	AGL37, PHE1	PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1)
AT5G26580	43 / 2e-05	MADS	AGL34	AGAMOUS-like-34 (.1)
AT5G27960	42 / 6e-05	MADS	AGL90	AGAMOUS-like 90 (.1)
AT5G26650	41 / 8e-05	MADS	AGL36	AGAMOUS-like 36 (.1)
AT3G05860	41 / 0.0001	MADS		MADS-box transcription factor family protein (.1.2.3)
AT5G26630	40 / 0.0003	MADS		MADS-box transcription factor family protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10007711 [exp]	86 / 2e-22	AT5G48670	83 / 5e-20	AGAMOUS-like 80 (.1)
Lus10022316 [exp]	85 / 1e-20	AT5G48670	131 / 2e-36	AGAMOUS-like 80 (.1)
Lus10014883 [exp]	74 / 1e-16	AT5G48670	114 / 1e-29	AGAMOUS-like 80 (.1)
Lus10007713 [exp]	71 / 1e-16	AT1G65330	74 / 1e-16	PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1)
Lus10004459 [exp]	59 / 2e-12	AT5G27810	46 / 6e-08	MADS-box transcription factor family protein (.1)
Lus10000400 [exp]	57 / 2e-11	ND	42 / 3e-06
Lus10001689 [exp]	56 / 3e-11	AT5G27810	51 / 5e-10	MADS-box transcription factor family protein (.1)
Lus10014578 [exp]	58 / 1e-10	AT5G48670	182 / 5e-56	AGAMOUS-like 80 (.1)
Lus10032108 [exp]	48 / 3e-07	AT5G48670	180 / 9e-55	AGAMOUS-like 80 (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.013G018100 [exp]	59 / 5e-11	AT5G48670	187 / 1e-58	AGAMOUS-like 80 (.1)
Potri.013G001700 [exp]	53 / 7e-09	AT5G48670	203 / 3e-64	AGAMOUS-like 80 (.1)
Potri.005G002400 [exp]	51 / 3e-08	AT5G48670	222 / 4e-71	AGAMOUS-like 80 (.1)
Potri.013G107600 [exp]	41 / 5e-05	AT1G22590	117 / 9e-34	AGAMOUS-like 87 (.1.2)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10022107 pacid=23146471 polypeptide=Lus10022107 locus=Lus10022107.g ID=Lus10022107.BGIv1.0 annot-version=v1.0

ATGAAGTGGAATCGTGTTGTCACCGCGACTGAGATCCACTATGCCCTTGTCAATCTCCTCAATTTTCTTGTCAATGCTCATGTAAACAAGGTTAAGATCA

TTCATGGTAAAATCTTAGAGCTCCATTCGGCCGGTGAGGCAATGGATCACCGCCTGGTCGACCTCCTTTTGGCGGTTTTCGAAGTCGTAGTTATTGTTCT

GTTTGCGGGTCTTCTTGATTCAGTCGACATTGGCAGCCAAGTCTCCGGTGGTTCCGCCTCATTGTATGGGTTATTGATGATGGCGCAAGCTTGGACGCCG

CAGAGGGTGCTTAGCTCCCTCACTTTCTTCATCAACCTGCTCTTCCACTTCTTGAATGATGCCTTCCTGACTGATAAGTTTGCTATGTACACTAGATTTA

CATTCTTTCTAGGCATTATTGATTGA

AA sequence

Show only first row Show all

>Lus10022107 pacid=23146471 polypeptide=Lus10022107 locus=Lus10022107.g ID=Lus10022107.BGIv1.0 annot-version=v1.0

MKWNRVVTATEIHYALVNLLNFLVNAHVNKVKIIHGKILELHSAGEAMDHRLVDLLLAVFEVVVIVLFAGLLDSVDIGSQVSGGSASLYGLLMMAQAWTP

QRVLSSLTFFINLLFHFLNDAFLTDKFAMYTRFTFFLGIID

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022107 [exp]	0	1

Lus10022107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.