Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030063 [exp] 86 / 1e-20 AT2G02160 126 / 3e-30 CCCH-type zinc finger family protein (.1) Lus10005558 [exp] 48 / 3e-07 AT3G42170 351 / 5e-111 BED zinc finger ;hAT family dimerisation domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G104000 [exp] 50 / 6e-08 AT3G42170 381 / 7e-123 BED zinc finger ;hAT family dimerisation domain (.1) Potri.001G383800 [exp] 50 / 7e-08 AT3G42170 387 / 4e-125 BED zinc finger ;hAT family dimerisation domain (.1) Potri.017G019466 [exp] 42 / 5e-05 AT3G42170 279 / 6e-82 BED zinc finger ;hAT family dimerisation domain (.1) Potri.011G125951 [exp] 42 / 5e-05 AT3G42170 313 / 2e-95 BED zinc finger ;hAT family dimerisation domain (.1) Potri.004G071450 [exp] 39 / 0.0003 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [flax] [poplar] C2H2-zf PF02892 [flax] [poplar] zf-BED BED zinc finger
Representative CDS sequence Show only first row Show all	>Lus10022109 pacid=23146486 polypeptide=Lus10022109 locus=Lus10022109.g ID=Lus10022109.BGIv1.0 annot-version=v1.0 ATGGAGTTTGGGAATCCCACCAACCATCCTAATGACAATGGTGATGCTGCCCCTGAAATTGGTAATCAGAATTTGAATGATGAAACTGCCCCTCAAGCTG ATGTTCCAGTGCCAAATCAAGAGCAACTCGTTCCTATTGAACTGAGTAAGTTGAAGAGTCCTGTCTGGGAACACTTTTCCAAGATTAAGGTTAATGATGC TATTAAAACAAAGTCCAACTACTGTAAGAGGTTGTTAGGTGGTCATTCTAGCAATGGTACTTTACACCTTACGTCTCATATTAAGTCTTGCTTGCAAAAA AAAAATTCTGATGGTTATCAAAGAGTGCTTGGTCCAAATTATGCCAGTCATGGTAAAAAGGAACTAGTTGCTGATTTGTGA
AA sequence Show only first row Show all	>Lus10022109 pacid=23146486 polypeptide=Lus10022109 locus=Lus10022109.g ID=Lus10022109.BGIv1.0 annot-version=v1.0 MEFGNPTNHPNDNGDAAPEIGNQNLNDETAPQADVPVPNQEQLVPIELSKLKSPVWEHFSKIKVNDAIKTKSNYCKRLLGGHSSNGTLHLTSHIKSCLQK KNSDGYQRVLGPNYASHGKKELVADL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022109 [exp]	0	1
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Lus10041344 [exp]	1.0	0.8935
					Lus10028091 [exp]	1.4	0.8798
					Lus10039427 [exp]	1.7	0.8660
AT5G19730			Pectin lyase-like superfamily ...		Lus10009997 [exp]	5.3	0.7865
					Lus10033844 [exp]	5.5	0.7942
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10029658 [exp]	7.7	0.8290
AT5G19580			glyoxal oxidase-related protei...		Lus10043230 [exp]	13.4	0.8129
AT5G57790			unknown protein		Lus10023209 [exp]	14.6	0.6366
					Lus10041330 [exp]	14.9	0.6757
					Lus10000400 [exp]	18.5	0.7627

Compare expression of checked genes

Lus10022109 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.