Plant FIBer expression Database

Lus10022111 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25660 265 / 5e-83 EMB2410 embryo defective 2410 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001860
[exp]
295 / 4e-95 AT2G25660 1582 / 0.0 embryo defective 2410 (.1)
Lus10012414
[exp]
48 / 5e-07 AT2G25660 167 / 1e-47 embryo defective 2410 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G034700
[exp]
267 / 2e-83 AT2G25660 2951 / 0.0 embryo defective 2410 (.1)
Potri.006G246401
[exp]
0 / 1 AT2G25660 0 / 1 embryo defective 2410 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0401 AsmA-like PF04357 TamB TamB, inner membrane protein subunit of TAM complex
Representative CDS sequence
>Lus10022111 pacid=23146484 polypeptide=Lus10022111 locus=Lus10022111.g ID=Lus10022111.BGIv1.0 annot-version=v1.0
ATGGAGCAAGACGCTCTCTCCCCTACGGAGGCTGCTAGAGTATTTGAGAGCCAATTGGCAGAATCCATATTGGAGGGTGATGGGCAACTTGCGTTTAAGA
AGCTAGCTACTGCAACTCTCGAGTCACTTATGCCAAAAATTGAAGGGAAGGGAAAACTCGGGCATGCTAGATGGAGGCTATTTTATGCTCCACAGATCCC
AAGTCTACTCTCTGTCAATCCCATGATTGATCCTTTGAAGTCTCTAGCCGGTACCATATCCTTTGGTGCAGAAGTTGAGGTCCAGCTCGGGAAACGCCTC
CAGGCTTCCATTGTTAGGCAGATGAAAGACTCGGAAATGGCTATGCAATGGACATTGATCTATCAGCTCACAAATCGGCTGAGAGTGCTGCTTCAGTCTG
CTCCTTCCAAATGCCTTCTCTTCGAGTACTCTGCAACCTCGCAGGACTAG
AA sequence
>Lus10022111 pacid=23146484 polypeptide=Lus10022111 locus=Lus10022111.g ID=Lus10022111.BGIv1.0 annot-version=v1.0
MEQDALSPTEAARVFESQLAESILEGDGQLAFKKLATATLESLMPKIEGKGKLGHARWRLFYAPQIPSLLSVNPMIDPLKSLAGTISFGAEVEVQLGKRL
QASIVRQMKDSEMAMQWTLIYQLTNRLRVLLQSAPSKCLLFEYSATSQD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111
[exp]
0 1
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278
[exp]
1.0 0.9207
AT5G66550 Maf-like protein (.1) Lus10040204
[exp]
2.0 0.9019
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842
[exp]
3.0 0.8910
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10019213
[exp]
4.0 0.8647
AT3G49142 Tetratricopeptide repeat (TPR)... Lus10027561
[exp]
4.1 0.8001
AT5G44440 FAD-binding Berberine family p... Lus10023367
[exp]
4.7 0.8180
AT1G31500 DNAse I-like superfamily prote... Lus10000006
[exp]
4.7 0.7935
AT4G37460 SRFR1 SUPPRESSOR OF RPS4-RLD 1, Tetr... Lus10014863
[exp]
5.9 0.8559
AT1G74350 Intron maturase, type II famil... Lus10017037
[exp]
6.2 0.7700
AT1G26930 Galactose oxidase/kelch repeat... Lus10024239
[exp]
6.9 0.8551

Lus10022111 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.