Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52490 39 / 0.0001 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021291 [exp] 83 / 4e-20 AT3G52490 690 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10016966 [exp] 83 / 5e-20 AT3G52490 606 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10024536 [exp] 64 / 3e-15 AT3G52490 57 / 5e-11 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10042638 [exp] 61 / 8e-14 AT3G52490 53 / 9e-10 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10004526 [exp] 60 / 5e-12 AT3G52490 75 / 1e-14 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009953 [exp] 50 / 5e-09 AT3G52490 68 / 1e-13 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G204500 [exp] 37 / 0.0007 AT3G52490 852 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022117 pacid=23146461 polypeptide=Lus10022117 locus=Lus10022117.g ID=Lus10022117.BGIv1.0 annot-version=v1.0 ATGTTTGATTATTTGGAGTTCTTGACGGCAGCCGTCGGGAATGAAGCCTCTATCCAAGATGAGCAGCTAGAAGTAACTAGGGCAGCGAAAGAAGATGTGG TCAGTGTGATTGAGAATTTAGTGAGCAATCGATCTAGAAGAAGAGGGGTGGTGATCGTAGGAGACTGCCCCCATAAAGCCGAAGGCGTTTTGAAAGGAGA ACATATGGAAATGGTCGAGAAGGGAGCTAAGTTTGTATCCATTGTCTTTAATTTTGGACAGCTTTGTACGACATAA
AA sequence Show only first row Show all	>Lus10022117 pacid=23146461 polypeptide=Lus10022117 locus=Lus10022117.g ID=Lus10022117.BGIv1.0 annot-version=v1.0 MFDYLEFLTAAVGNEASIQDEQLEVTRAAKEDVVSVIENLVSNRSRRRGVVIVGDCPHKAEGVLKGEHMEMVEKGAKFVSIVFNFGQLCTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022117 [exp]	0	1

Compare expression of checked genes

Lus10022117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.