Plant FIBer expression Database

Lus10022120 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32690 234 / 3e-80 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007678
[exp]
0 / 1 AT4G32690 72 / 1e-28 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G244300
[exp]
241 / 5e-83 AT4G32690 262 / 6e-91 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
Potri.018G036200
[exp]
82 / 3e-21 AT4G32690 119 / 7e-36 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0090 Globin PF01152 Bac_globin Bacterial-like globin
Representative CDS sequence
>Lus10022120 pacid=23146482 polypeptide=Lus10022120 locus=Lus10022120.g ID=Lus10022120.BGIv1.0 annot-version=v1.0
ATGCAGACTCTCCAAGAGAAAGCATCCCAGTGGAGCGGAGTCGACCCAGCCGACGCCTTCGCCATTGACCAGACCAACCTCTTCCACAAATTAGGTCTCC
AAACCTTCATCGACCTCTCCACTAACTTCTACAACAGGGTTTACGATGACGACGAAGAGGAGTGGTTTAGATCGATATTTGCTAACTCCAAGAAAGAGGA
AGCAATCCAGAACCAGTACGAGTTCTTTGTGCAGAGGATGGGCGGGCCTCCCTTGTATTCTCAGAGGAAAGGTCACCCTGCTCTTATAGGACGACACAGG
CAGTTCCCAGTAACACACCAAGCTGCGGAGAGGTGGCTGCATCACATGCAAAACGCATTGGATAGCACCCCAGAGATAGACTCGGAATCCAAAATCATAA
TGATGAATTTTCTCAGGCAAGACTTGAACAATTCCATGTCTGAATCATCTATTCTATGA
AA sequence
>Lus10022120 pacid=23146482 polypeptide=Lus10022120 locus=Lus10022120.g ID=Lus10022120.BGIv1.0 annot-version=v1.0
MQTLQEKASQWSGVDPADAFAIDQTNLFHKLGLQTFIDLSTNFYNRVYDDDEEEWFRSIFANSKKEEAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHR
QFPVTHQAAERWLHHMQNALDSTPEIDSESKIIMMNFLRQDLNNSMSESSIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Lus10022120
[exp]
0 1
AT2G44380 Cysteine/Histidine-rich C1 dom... Lus10003919
[exp]
3.2 0.9639
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10006032
[exp]
7.7 0.9405
AT3G29320 PHS1 alpha-glucan phosphorylase 1, ... Lus10029644
[exp]
8.1 0.9366
AT3G58180 ARM repeat superfamily protein... Lus10006688
[exp]
8.9 0.9310
AT5G55410 Bifunctional inhibitor/lipid-t... Lus10032575
[exp]
9.2 0.9510
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10040992
[exp]
9.8 0.9426
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10003022
[exp]
11.2 0.9371
AT1G22520 Domain of unknown function (DU... Lus10009454
[exp]
14.0 0.9214
AT5G57090 MM31, ATPIN2, A... WAVY ROOTS 6, ETHYLENE INSENSI... Lus10001637
[exp]
14.9 0.9450
AT2G04400 Aldolase-type TIM barrel famil... Lus10012310
[exp]
16.1 0.9391

Lus10022120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.