Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25737 82 / 1e-19 Sulfite exporter TauE/SafE family protein (.1) AT2G36630 70 / 2e-15 Sulfite exporter TauE/SafE family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011683 [exp] 109 / 1e-29 AT2G25737 444 / 9e-154 Sulfite exporter TauE/SafE family protein (.1) Lus10011682 [exp] 81 / 3e-19 AT2G25737 632 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Lus10026025 [exp] 80 / 1e-18 AT2G25737 533 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Lus10014316 [exp] 79 / 1e-18 AT2G25737 536 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Lus10020733 [exp] 69 / 6e-15 AT2G36630 611 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Lus10029813 [exp] 69 / 6e-15 AT2G36630 612 / 0.0 Sulfite exporter TauE/SafE family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G242100 [exp] 89 / 3e-22 AT2G25737 568 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Potri.018G037400 [exp] 88 / 7e-22 AT2G25737 535 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Potri.003G053000 [exp] 86 / 4e-21 AT2G25737 501 / 2e-175 Sulfite exporter TauE/SafE family protein (.1) Potri.007G026800 [exp] 85 / 9e-21 AT2G25737 434 / 2e-149 Sulfite exporter TauE/SafE family protein (.1) Potri.001G182700 [exp] 84 / 2e-20 AT2G25737 428 / 6e-147 Sulfite exporter TauE/SafE family protein (.1) Potri.005G124200 [exp] 84 / 2e-20 AT2G25737 453 / 1e-156 Sulfite exporter TauE/SafE family protein (.1) Potri.018G037500 [exp] 83 / 6e-20 AT2G25737 529 / 0.0 Sulfite exporter TauE/SafE family protein (.1) Potri.001G183400 [exp] 82 / 8e-20 AT2G25737 418 / 5e-143 Sulfite exporter TauE/SafE family protein (.1) Potri.001G183300 [exp] 81 / 2e-19 AT2G25737 381 / 2e-128 Sulfite exporter TauE/SafE family protein (.1) Potri.006G117900 [exp] 65 / 2e-13 AT2G36630 578 / 0.0 Sulfite exporter TauE/SafE family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0292 [flax] [poplar] LysE PF01925 [flax] [poplar] TauE Sulfite exporter TauE/SafE
Representative CDS sequence Show only first row Show all	>Lus10022133 pacid=23146448 polypeptide=Lus10022133 locus=Lus10022133.g ID=Lus10022133.BGIv1.0 annot-version=v1.0 ATGGGGTTTGGGTGGAGACTAGTGGGAGCAAGTGTGATTGGATTCCTGGGAGCAGCATTTGGGAGTGTCGGGGGAGTTGGGGGAGGAGGCATAGTCGTAC CAGTGCACACTCTCATCATTGGCTTCGATCCTAAATCTGCTACAGCCATCTCCAAGTGTATGATAACTGGAGCAGCTGTTGCTACGGTGGTGTACAATCT CAAGTTGAGACATCCCACTCTTGATCTCCCCATTGTGGAATATGTTGCTCATTCAACCTGTCTTGTTGCTGGGGAACAGTATTGGCGTTACCTTTAA
AA sequence Show only first row Show all	>Lus10022133 pacid=23146448 polypeptide=Lus10022133 locus=Lus10022133.g ID=Lus10022133.BGIv1.0 annot-version=v1.0 MGFGWRLVGASVIGFLGAAFGSVGGVGGGGIVVPVHTLIIGFDPKSATAISKCMITGAAVATVVYNLKLRHPTLDLPIVEYVAHSTCLVAGEQYWRYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10022133 [exp]	0	1
					Lus10011795 [exp]	2.0	0.8171
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10002089 [exp]	3.0	0.8223
AT3G15130			Tetratricopeptide repeat (TPR)...		Lus10007683 [exp]	12.5	0.7506
AT1G72970		HTH, EDA17	HOTHEAD, embryo sac developmen...		Lus10037640 [exp]	13.0	0.8033
AT5G51460		ATTPPA	Haloacid dehalogenase-like hyd...		Lus10027208 [exp]	15.5	0.7440
AT5G01790			unknown protein		Lus10030550 [exp]	16.7	0.7815
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10003854 [exp]	16.9	0.7782
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10000338 [exp]	21.9	0.7544
AT4G35780		STY17	serine/threonine/tyrosine kina...		Lus10026461 [exp]	24.9	0.8054
AT3G59310			Eukaryotic protein of unknown ...		Lus10004060 [exp]	25.5	0.7512

Compare expression of checked genes

Lus10022133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.